KEGG   Halalkalicoccus jeotgali: HacjB3_04120Help
Entry
HacjB3_04120      CDS       T01271                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hje01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hje00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(812533..814197)
Genome map
AA seq 554 aa AA seqDB search
MLHAEGPLCSIDLTERTVETEDIDDVLSSFIGGRGVGTKLAFDRVPFDADPLGPENRLYF
TTGPMQASRMSYTGRTNATALSPLTDGLVSSNAGGFVSRNLAGTGYGAIEFKGRSDEPIA
IHITDQGVEFDPVPDLAGALVSEVTEYVESRDLTEENAVAIGPAGENLVRFASIMTTESR
AFGRGGLGAVLGSKNVKAITFDGDSHPEIEIPDVQNDVHREAATTDHIMKRQGTTSVTDL
ANEVNGLPTRYFSEQRFEGAEGINGDRVEEKKFKKGTCSACAFACKLPTRDEERGVETEG
PEFETVMAFGSNCAIDDIVDVMQSNELCDEFGLDTISCGNTIAGYLASEDAFGDAQLIHD
TVERIAHREGVGDTLAEGISRAHEDLGVENWTVKHLSFAGHEGRTLHGQGLAYAVANRGA
DHMYSTFYAWEYPLVGKDDAFPQGGFEGKPEAVVTQENTRALEDCGIVCRFSRGIMNPER
YENLFSADYEDLLDVGARVIGMERQFNNERGFDRGDDTLPYVDQLEGFDDALSEYYAVRG
WNDDGTVAGVSADD
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcttcacgccgaggggccgctgtgctcgatcgacctgaccgagcgcacggtcgaaacc
gaagacatcgacgacgttttgtccagttttatcggcggacggggcgtcggaacgaagctc
gccttcgacagagttccgttcgacgccgacccgctgggccccgagaaccggctctacttc
accaccggcccgatgcaggccagccggatgagctacaccggccggacgaacgcgacggcc
ctctcgccgctgactgatggcctcgtctcctcgaacgccggcgggttcgtctcgcgcaac
ctcgccgggacgggctacggcgcgatcgagttcaaaggacggagtgacgagccgatcgcg
atccatatcaccgaccagggcgtcgagttcgatcccgtaccggatctggcgggtgcactc
gtctcggaagtcaccgagtacgtcgaaagtcgtgacctcaccgaggagaacgccgtcgcg
atcggccccgccggcgagaatttggtgcggtttgcctcgatcatgaccaccgaatcgcgc
gcgttcggccggggcgggctcggggccgttctcggatcgaagaacgtcaaggcgatcacc
ttcgacggcgattcacatcccgaaatcgagatccccgacgtccagaacgacgtgcatcgc
gaggccgcgacgaccgatcacattatgaaacgccagggtaccacctcggtgaccgacctc
gcgaacgaggtcaacggcctccccacccggtacttctccgaacagcgcttcgagggcgcg
gaggggatcaacggcgatcgcgtcgaggagaagaagttcaagaaggggacctgttctgcg
tgtgccttcgcctgtaagctccccacgcgcgacgaggaacgcggtgtcgagaccgaaggc
cccgagttcgagacggtgatggccttcggctcgaactgcgcgatcgacgacatcgtcgac
gtgatgcagtcgaacgagctctgtgacgagttcggcctcgacaccatctcctgtggcaac
actattgccgggtatctcgcgagcgaggacgccttcggcgacgcacagttgatccacgac
acggtggaaaggatcgcccacagggagggcgtcggcgataccctcgccgagggaatcagc
cgcgctcacgaggacctcggcgtcgagaactggacggtcaagcacctctcgtttgcgggc
cacgagggccgcacactccacggccagggactggcctacgcggtcgcgaaccgcggtgca
gaccacatgtactcgacgttttacgcctgggagtacccgttggtggggaaggacgacgcg
ttcccccagggcggcttcgagggcaagcccgaggcggtcgtcacccaggagaacacccgg
gcactggaggactgcgggatcgtctgtcggttttcgagagggatcatgaaccccgagcgc
tacgagaacttgttctcggccgactacgaggacctgctcgatgtcggcgcgcgcgtcatc
gggatggaacgccagttcaacaacgagcgcgggttcgaccggggcgacgacaccctgccg
tacgtcgatcagttggagggcttcgacgacgccctcagcgagtactacgcggtccggggc
tggaacgacgacggcaccgtcgcgggggtgtcggccgacgactga

DBGET integrated database retrieval system