KEGG   Halalkalicoccus jeotgali: HacjB3_04130Help
Entry
HacjB3_04130      CDS       T01271                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HacjB3_04130
Enzymes [BR:hje01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     HacjB3_04130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
815805..816851
Genome map
AA seq 348 aa AA seqDB search
MVGSDDGAPDTGSTAEDSPAARFRERVPESSVELAYAGLNTFLKGDPRDVADLSESDVGV
LGAPYDGAVSNRPGARYGPEAIRRASAWWAYLSGYKGGLTNMGTGEQVDFSNLSIADCGD
IPVFPMDRETTAESITAHVATVAQRAFPVMLGGDHYCTYPAVRGFAEGIDAGSVGLVQID
AHTDTVAESAVFGEHFHGSSTHHIADSEYAEYENVSQVAIRGYESPDFFDFADEVGLNLF
TMNAVREEGIERVVERAVEAAAEGTDAVYVTFDIDAVDPSVAPGTGTPVPGGLSAEEALS
VMDVLGASEAVGAVDLMEVAPTYDPSEGTGRLGAYLLVRFLEQKFAAQ
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtcggatccgacgacggcgctccggacacgggcagtacggccgaggactcccccgcc
gcgcgctttcgcgagcgagtacccgaatcgagcgtcgaactcgcctacgccgggctcaac
acctttctcaaaggtgatcctcgcgacgtggcggacctctctgagagcgatgtcggcgta
ctcggcgcgccctacgacggcgcagtgagcaatcgtccgggggcgcgctacggccccgag
gcgatccgccgggccagcgcgtggtgggcgtatctctcggggtacaagggcgggctgacg
aacatggggacgggcgagcaggtcgacttctcgaacctgtcgatcgccgactgtggcgat
attcccgtctttccgatggatcgcgagacgaccgccgagagcatcaccgcccacgtcgcg
acggtcgcccagcgggcgttcccggtcatgctcggtggcgatcactactgtacgtacccc
gccgtccggggcttcgccgaggggatcgacgccggttccgtaggactggtccagatcgac
gcccacaccgataccgtcgccgaaagtgccgtcttcggcgagcattttcatggttctagc
acccaccacatcgccgactccgagtacgcggagtacgaaaacgtcagccaggtcgcgatt
cgaggctacgagagccccgacttcttcgacttcgccgacgaagtgggactgaacctcttt
accatgaacgcggtgcgagaagaggggatcgagcgggtggtcgagcgggcggtcgaagcc
gcagcggaaggcaccgacgcggtctacgtcaccttcgacatcgacgcggtcgatccgtcc
gtggctcccgggaccgggacgccggtccccggcggactgtcggccgaggaggcgctctcg
gtgatggacgtcttgggggcgagcgaggccgtcggcgcggtcgacctgatggaggtcgcg
ccgacctacgacccgagcgaggggaccgggcgactgggggcgtacctgctggtgcggttc
ctggagcagaagttcgccgcacagtag

DBGET integrated database retrieval system