KEGG   Halalkalicoccus jeotgali: HacjB3_05985Help
Entry
HacjB3_05985      CDS       T01271                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00250  Alanine, aspartate and glutamate metabolism
hje01100  Metabolic pathways
hje01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HacjB3_05985
Enzymes [BR:hje01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     HacjB3_05985
Peptidases [BR:hje01002]
 Cysteine Peptidases
  Family C44
   HacjB3_05985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6
Motif
Other DBs
NCBI-ProteinID: ADJ14588
UniProt: D8JA66
Position
complement(1122527..1124314)
Genome map
AA seq 595 aa AA seqDB search
MVGLCGSYGSRRLDVEPIAAALSRSETDERFEYGTGRLRGSVIAHDRAGRPATVPGEGAS
LVVWGAVYSRERQQGYERRPPEVTTAEFCARAYAEDGIEALAEMNGEFVCLVEHPDGDRV
RIVTDRLGTRPVYYRAERGAITFSTSIQALAGHPGIETGYVPEYLAEYLGTKTVRGLHTP
LSGIEQLPPASVVTLDPDAGEVRAERYWQPIHRPENRPLSAFVDQFTERFLDAIDDRIRA
DRRYGLLLSGGSDSRLVLATLDRVDAYGFADPSGEVETARLVADLAGVPFTRFEHEPGYD
RRLLRRNAAVSNFVGWFNEGRAIGVEATLRREVDALVSGLYADVLFKGWTTPTRRLSVPG
ASLPVPAAQNIETRADVLEARDTSTPPYLPDGVVERAHERNLSTGTPVVDHGMAYSSYGA
LSAHGFWFPLTNETSFDRYSDGQVLPTVHPFLDRRLIDLALRMPRAYALRYNLVDRALAR
LAPELAAVPHDASGLALSRPRWLHRLATMGAELRSDAAGNAATLRETDWIERLFERREPT
IRALPLVEYDAVRRTYDAHMAGADHTAALCGLLTLLEMPITRTVTASRHERTPTP
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcctctgtggatcgtacggctcgcgacgcctcgacgtcgaaccgatcgccgcg
gcgctctcgcgttccgagacggacgaacgcttcgagtacgggacggggcgactccgcggt
agcgtgatcgctcacgaccgggcggggcgaccggccacggtccccggagagggtgcctcg
ctggtcgtctggggggcagtctacagccgggaacgacagcaggggtacgagcggcgcccg
ccggaggtcaccacggccgagttctgcgcccgggcctacgccgaggacggtatcgaagcg
ctggcggagatgaacggcgagttcgtctgtctcgtcgagcacccggacggcgaccgggtc
cggatcgtcaccgatcggctgggaacacgaccagtatactaccgtgccgaacgcggggcg
atcacgttctcgacgtcgatccaggcccttgcgggccacccggggatcgagaccgggtac
gtccccgagtacctcgcggagtatctgggaacgaagaccgtccgcgggctgcacacgccg
ctttcggggatcgaacagctcccgccggcgtcggtcgtgaccctcgatcccgacgccggc
gaggtgcgggccgaacggtactggcaaccgattcaccggcccgaaaaccgcccgttgtcg
gcgttcgtcgatcagtttaccgagcggttcctcgacgcgatcgacgaccggatccgcgcc
gaccggcgatacgggctgttgctctcgggaggcagcgactcgcgcctcgtcctcgcgacg
ctggatcgcgtcgacgcctacggcttcgcggacccctcgggcgaggtcgaaaccgcacga
ctggtggccgatctcgccggcgtcccgttcactcgcttcgagcacgaacccggatacgac
aggcgcctgctccggcgcaacgccgcggtgagcaacttcgtcggctggttcaacgaaggc
cgggcgatcggcgtcgaggcgaccctgcgccgcgaggtcgacgcgctcgtctccgggctc
tacgcggacgtgctgttcaagggctggacgacaccgactcgccgcctctcggttccgggg
gcatcgctgccggttccggccgcccaaaacatcgaaacgcgcgcggacgtcctcgaagcg
cgggacacgtcgacaccgccgtacctgcccgacggcgtcgtcgagcgagcccacgagcga
aacctctcgaccgggaccccggtggtcgatcacgggatggcctactcgtcctacggtgcg
ctctcggcccacgggttctggttcccgctgaccaacgagacctccttcgaccgctacagc
gacgggcaggtcctcccgacggtccacccgttcctcgaccggcggctgatcgatctcgca
ttacggatgcccagggcgtacgcgctgcggtacaacctcgtcgaccgggcgctcgcgcgc
ctcgcacccgaactggccgccgtcccccacgacgcgagcggactggccctctctcggccc
cggtggctccaccgcctcgcgacgatgggcgcggaactgcgctcggacgccgccggcaac
gcggcgacgctcagggaaaccgactggatcgagaggctcttcgagcgccgcgagccgacc
attcgggccctgcccctagtggagtacgacgccgtccggcggacctacgacgcccacatg
gcaggggccgaccataccgccgcgctctgcggtctgttgacgctgctggagatgccgatc
acccggacggtgaccgcgtcgcgacacgaacggacgccgacaccctaa

DBGET integrated database retrieval system