KEGG   Halalkalicoccus jeotgali: HacjB3_06875Help
Entry
HacjB3_06875      CDS       T01271                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HacjB3_06875 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HacjB3_06875 (sucC)
   00640 Propanoate metabolism
    HacjB3_06875 (sucC)
   00660 C5-Branched dibasic acid metabolism
    HacjB3_06875 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HacjB3_06875 (sucC)
Enzymes [BR:hje01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HacjB3_06875 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1285709..1286854)
Genome map
AA seq 381 aa AA seqDB search
MKLHEYQAKSVFADAGIPTPDSQLAESTEEVLSAAESVGYPVAVKAQVQVGGRGKAGGIE
LVENDEEAREAADSILGMDLKGYTVERVLVEEAVDFVDELYVGVTMDRGEGKPVAMVSRK
GGVNIEEVAEEDPDAIAREHVDPAFGLQPYQARRVVYDAGIDREVAGDVSSVLTTLFSLW
DDRDASDTEINPLMVTSDGEVIAADAVMNIDEDALFRQAELAEMEEESYTDDLERKAGEY
GFDYVRLEGDVGIIGNGAGLVMTTLDLVDYYGGEPANFLDVGGGAKADRIANALDMVFSD
ENVESVVFNIFGGITRGDEVAKGINNALEQFDEIPKPVVVRLAGTNAEEGMEILNADLVQ
VEQTLEEAVQRAVENAQEVHQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccacgagtatcaggcgaagtcggtgttcgccgacgcgggcatcccgacgccc
gattcgcaactcgcagaaagcaccgaggaggtgctgtctgcggccgagtcggtcgggtat
ccagtcgccgtcaaggcgcaggtgcaggtcggtgggcgcggcaaggccggcgggatcgaa
ctcgtcgagaacgacgaggaggcccgcgaggccgccgactcgatcctggggatggacctg
aaaggctacaccgtcgaacgcgtcctcgtcgaggaggccgtcgacttcgtcgacgaactc
tacgtcggcgtgacgatggaccggggcgaagggaaacccgtcgcgatggtctcacgaaag
ggcggtgtgaacatcgaggaagtcgcagaagaggaccccgacgcgatcgcccgcgagcac
gtcgaccccgccttcggcctccagccctatcaggcccgccgggtggtctatgacgccggg
atcgaccgcgaggtcgcaggcgacgtttcgagcgtcctcacgacgctcttttcgctctgg
gacgaccgcgacgcctccgataccgaaatcaacccgctgatggtcaccagcgacggcgag
gtcatcgcggccgacgccgtgatgaacatcgacgaggacgcgctctttcgccaggccgag
ctggccgaaatggaagaggagtcctacaccgacgacctcgaacgaaaggccggcgagtat
ggcttcgactacgtccgcctggagggcgacgtcggcatcatcggcaacggcgccggtctc
gtgatgacgacgctcgacctggtcgattattatggtggtgagcccgcgaacttcctcgac
gtcggtggcggtgcgaaagccgaccggatcgcgaacgcgctggacatggtcttttccgac
gagaacgtcgagtcggtcgtgttcaacatcttcgggggcatcacccgcggcgacgaggtc
gcaaaggggatcaacaacgccttagagcagttcgacgagattccgaaaccggtcgtcgtc
cgactggcggggacgaacgccgaggagggcatggaaatcctgaacgccgatctagtacag
gtcgaacagacgctggaggaagcggttcagcgtgccgtcgagaacgcacaggaggtccac
caatga

DBGET integrated database retrieval system