KEGG   Halalkalicoccus jeotgali: HacjB3_07600Help
Entry
HacjB3_07600      CDS       T01271                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hje00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1411859..1412986
Genome map
AA seq 375 aa AA seqDB search
MQTVEAAGLGIGDDHPPRIMGVLNVSEESPYDPSVFADPGEAAAYVERELIEEGADIVDV
GLESANKRLDVLSPEAELDRLDTAVETLESVSSEAVFSIETRYSEVADAALSRGFDMVND
VCGFADPAMPETCRAHDAAVVKMASPPDLERPGAVESVDGIYEALSMNGFTEKTILDPAF
GGWSPEKSLADDRETLSRLREFRAYGRPLLVSINRKNFLRDIAGRSTEKALPVSLAATAM
AVERGAHVLRTHDVAETRDAALIGREFSRERVREPTVEELDVTSHREAARHLERVDGDAE
LADAGVTRWFRLSDLGDAAQALALAVADTEGVSLAGTDPTLLFGTRDGFASLNRAVPAET
GPLPELLSKILDDFS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgtcgaggccgccggattggggatcggcgacgaccacccgccgcggatcatg
ggcgttctcaacgtcagcgaggaatcgccgtacgatccgagcgtcttcgccgaccccggc
gaggcggccgcgtacgtcgagcgcgaactgatcgaggagggcgccgacatcgtcgacgtc
ggccttgaatccgcgaacaaacgcctcgacgtactctcccccgaggcggaactcgaccgc
ctcgataccgccgtcgagaccctcgaatccgtctcgagcgaggcggtcttctcgatcgaa
acgcgctactcggaggtcgcagatgcggcgctctcgcgggggttcgacatggtcaacgac
gtctgtgggttcgccgaccccgcgatgcccgaaacctgtagagcgcacgacgccgccgtc
gtcaagatggcctcgccgccggacctcgaacgccctggtgcggtcgagtccgtcgacggg
atctacgaggccctctcgatgaacggctttaccgagaagacgatcctcgatcccgccttc
gggggctggagcccggagaagtccctcgcggacgaccgcgagaccctctccagattacgg
gagtttcgcgcctacggtcggcccctgctggtgtcgatcaaccgcaagaacttcctgcgc
gatatcgccggtcgcagtaccgaaaaggcgcttccggtttcgctggcggcgaccgcgatg
gcggtcgagcggggggcacacgtcctcagaacgcacgacgtggccgagacgcgcgacgcc
gcgttgatcggccgggagttctcccgcgagcgcgttcgcgaacccacggtcgaggaactc
gacgtgaccagccaccgcgaggccgcccgccacctcgaacgcgtcgacggggacgccgaa
ctggccgacgcgggcgtcacccgctggtttcgcctctcggatctcggggacgccgcccaa
gcgctcgccctcgcggtcgccgacacggagggggtctccctcgccggcaccgatccgaca
ctcctctttggcacccgggacgggttcgcctcgctgaatcgagcggtaccggccgaaacg
ggccctctcccggaattactctcgaagatcctagatgatttcagctaa

DBGET integrated database retrieval system