KEGG   Halalkalicoccus jeotgali: HacjB3_07620Help
Entry
HacjB3_07620      CDS       T01271                                 

Definition
N5N10-methylenetetrahydromethanopterin reductase
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1416238..1417236)
Genome map
AA seq 332 aa AA seqDB search
MTARDVHLPVAAQSGVDSLVADARRAERTGYDRVWLPETWGRDAATVLAVIAERTDSVGL
GASILPVYSRSPALIGQTAATLQEVSEGRFRLGIGPSGPAVIEGWHGESFERPLKRTRET
VEIVRRVLSGERVEYDGEIFGLSGFRLRSDPPETAPGIDVAGLGPKSVELAGRFGDGWHA
VVFTPDGIRDRLADLERGAELGDRDPAELRTTLSLTCCALADRERARELARQHTAFYVGG
MGTYYRESLARQGYEEEANAVASAWGSGDREAALAAIPDELLDDLCAAGTPEEARETIER
FEAVEGLDAVAVSFPRGASEDEIEATIDTLAP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccgggacgtccacctgcccgtggccgcccaatcgggggtcgactcgctggtc
gccgacgcgcggcgggccgagcgaacgggctacgaccgggtctggcttcccgagacgtgg
ggccgggacgccgcgaccgtgctcgcggtcatcgccgagcgcaccgactcggtcgggttg
ggtgcgagtatccttcccgtttactcgcgctcgccggcgctgatcggtcagactgccgcg
accctccaagaggtgagcgaggggcgattccgcctcgggatcggcccgagcggccccgcc
gtgatcgaaggctggcacggcgagtccttcgagcggccactcaagcggacccgcgagacc
gtcgagatcgtccggcgagtactctccggcgagcgcgtcgagtacgacggcgagatattc
ggactctcggggttccgactccggagcgacccccccgaaaccgcgcccggaatcgacgtc
gccgggctcggcccgaagtcggtcgaactcgccggtcggttcggggacgggtggcacgcc
gtcgtcttcacgcccgacggcatccgggaccggctcgccgacctcgaacggggtgcggaa
ctaggggatcgagatcctgccgagctacggacgaccctctcgctgacctgctgtgcccta
gcggaccgcgagcgcgctcgcgaactcgctcgccagcacaccgccttctacgtcggcggg
atgggcacctactaccgcgagtcgctggcccgccagggctacgaggaggaagcgaacgcc
gtcgcctcggcgtggggcagcggcgatcgcgaggcggcgttggcggcgatccccgacgag
ttgctcgacgacctctgtgcagcgggcacgcccgaggaggcccgcgagacgatcgagcgc
ttcgaggccgtcgaggggctcgacgccgtcgcagtgagctttccccgcggggcgagtgag
gacgagatcgaagcgacgatcgacacgctcgcgccctaa

DBGET integrated database retrieval system