KEGG   Halalkalicoccus jeotgali: HacjB3_07845Help
Entry
HacjB3_07845      CDS       T01271                                 

Definition
(GenBank) FAD dependent oxidoreductase
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Rieske FAD_binding_2 FAD_binding_3 NAD_binding_8 Pyr_redox_2 Amino_oxidase HI0933_like Pyr_redox_3 Thi4 GIDA FAD_oxidored Lycopene_cycl Trp_halogenase Pyr_redox AlaDh_PNT_C UDPG_MGDP_dh_N NAD_binding_9 NAD_binding_7 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADJ14954
UniProt: D8J2J7
Position
complement(1453084..1454607)
Genome map
AA seq 507 aa AA seqDB search
MDDHGRTRDESPWLATTDGPRFSALSGDRTVDVVVIGGGIAGLSTAVHLAESGTDVAVIE
RDRVGAAVTGHTTAKVTSQHGLKYDHLLETVGEERARQYAEANEAALAEVAERSEEFDAE
FERRDAYLYAEDSAGREQVREEARAAGGLGLPAEFVEPNELDLPYDTAGAVRFSEQGQFH
PRKYVLGLAEGVEAAGGTVFEETRATDLEVGEPCEVTTQSGVVAADAVVCATHFPVFDRG
GYFARMETKRSHVIGVRVAGDPPKGMYYKAGDPYRSIRVHRLDGEPLVLVGGENHETGRG
GSTKERYERLAEFAREHFDVREIAYRWSTQDYKPFDGVPYIGRLGPVGENAYVATGFGGW
GMTGGVAAGRIIAGLIDEGEHPQQDVFSPARITEKSAASFLTHNAAVGANFTADWARSLL
AGEEATLRAGEGTVIKTDDGPVGVSRSESGDLHAVSAVCPHMKCVLRWNDGEASWDCPCH
GSRFTPEGRVLDGPAIEDLPRRTAREK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcacggacgaacccgcgacgaatcgccgtggctcgcgacgaccgacggcccg
cgattctcggcgctttcgggcgaccggacggtcgatgtggtggtgatcggagggggtatt
gcgggactctcgactgccgtccacctcgccgaaagcggaacggacgtcgcggtgatcgag
cgcgaccgggtcggcgcggcggtgacgggccacaccaccgcgaaggtcacctcccagcac
ggcctgaagtacgaccacctgctcgaaaccgtcggcgaggaacgggcccgccagtacgcc
gaggccaacgaggccgccctcgcggaggtcgccgagcgaagcgaggaattcgacgccgag
ttcgagcgacgggacgcttacctctacgccgaggactcggcgggacgcgagcaggtccgc
gaggaggcacgggcggcaggcgggttgggactgcccgccgagttcgtcgaacctaacgag
ctcgatctcccctacgacactgctggcgcggtccggttttccgagcaggggcagttccac
ccccggaagtacgtcctcgggctggctgaaggcgtcgaggcggcgggcggcaccgtcttc
gaggaaacgcgggcgaccgacctcgaggtcggtgagccctgcgaggtcacgacccaaagc
ggggtcgtcgccgccgacgccgtcgtctgtgcgacgcactttcccgtgttcgaccgcggc
ggttacttcgcgcgaatggagacgaaacgctcgcacgtcatcggggtgcgggtcgcgggt
gaccccccaaaggggatgtactacaaggcgggcgatccctaccgctcgatccgcgttcac
cggttggacggcgaaccgctcgtcctcgtgggcggcgagaaccacgagacgggacgggga
gggtcgacgaaagagcgctacgaacgcctcgcggagttcgcccgcgagcacttcgacgtt
cgggaaatcgcctatcgttggtcgacccaggactacaaaccgttcgacggggtgccctac
atcggtcggctcggaccagtgggcgagaacgcctacgtcgcgaccggcttcggtggctgg
gggatgaccggcggcgtcgcggccggccggatcatcgcgggactgatcgacgagggcgag
catccccagcaggacgtgttctcgcccgcgcggatcaccgagaagtcggcggcgtcgttt
ctgacccacaacgccgcggtcggcgcgaacttcaccgccgactgggcacgctcgcttttg
gccggcgaggaggcgacgctgcgcgcgggcgaggggaccgtgataaagaccgacgacggg
ccggtcggcgtctcgcgatccgaatcgggcgacctgcacgccgtctcggcggtctgcccg
cacatgaagtgtgtgcttcgctggaacgacggcgaggccagttgggactgtccgtgtcac
ggctcgcgctttacccccgagggacgggtgctcgacgggccggcgatcgaggaccttccg
cgccgaacggcacgggagaagtga

DBGET integrated database retrieval system