KEGG   Halalkalicoccus jeotgali: HacjB3_07850Help
Entry
HacjB3_07850      CDS       T01271                                 

Definition
(GenBank) phosphoribosylamine--glycine ligase
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00230  Purine metabolism
hje01100  Metabolic pathways
hje01110  Biosynthesis of secondary metabolites
hje01130  Biosynthesis of antibiotics
Module
hje_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HacjB3_07850
Enzymes [BR:hje01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     HacjB3_07850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GARS_A GARS_N GARS_C ATPgrasp_Ter ATP-grasp_3 ATPgrasp_ST CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADJ14955
UniProt: D8J2J8
Position
complement(1454660..1455982)
Genome map
AA seq 440 aa AA seqDB search
MSETVLLVGGGGREHAIARALEGSDCELYACAGNRNPGIDRIAAGFETFDTTNTSAVTTY
AEEVGATLAVIGPEAPLQAGVADALSDAGVFPFGPSAEGAKIETDKAYQRRFMREHDIPG
CPEFETFESTEDACAYIDSSEADLAVKPAGLTGGKGVKVIGDQVDKEGAKAYLREETYDR
VVLEERFVGEEFTVQGLVANGSLRVTPAVQDHKRAYEGDEGPNTGGMGSYSDAGLELPFL
TEDEYRDAVGILDETVAALGDYTGVLYGQFMLTADGVKVIEYNARFGDPEAMNTLPVMNT
DFLDVLVAAREGEDLPQLSFAPRATVCKYAVPEGYPDDPQGGTPIEVDEETVAQAASATV
ETNGDARLFYASVDSRDDGVYTTTSRAFAVVGIAETISEAEGIAERALSNADEGVRIRHD
IGTEELVQSRIDHAAELRGE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagacggtgttgctggtcggcgggggtgggcgcgaacacgccatcgcgcgggcg
ctcgagggcagcgactgtgaactctatgcctgtgccggcaaccgcaacccgggaatcgac
cggatcgcagcgggattcgagacgttcgatacgacgaacacgagtgccgtgacgacctac
gccgaggaggtcggtgcgaccctcgccgtgatcggccccgaggcacccctgcaggcgggc
gtggccgacgcgctctcggacgcgggggtcttcccgttcggcccgagcgccgagggggcc
aaaatcgagacggacaaggcctaccagcgccggttcatgcgcgaacacgacattccgggt
tgtcccgagttcgagaccttcgagagtacggaggacgcctgtgcgtacatcgattcctcc
gaagccgacctcgcggtgaaacccgccggcctcaccggagggaagggcgtgaaggtcatc
ggcgatcaggtcgacaaggagggcgcgaaggcgtacctccgcgaggagacctacgaccga
gtcgtcttagaggaacgcttcgtcggcgaggagttcaccgttcaaggactcgtcgcgaac
ggttctctcagagtgaccccggcggtccaggatcacaagcgcgcctacgagggcgacgag
gggccaaacaccggcgggatggggtcctacagcgacgcgggcctcgaactcccgttcctg
accgaagacgagtaccgagacgccgtcgggatcctcgacgagacggtcgcggcgctcggc
gattatacgggggtgctctacgggcagttcatgctgaccgccgacggggtgaaggtcatc
gagtacaacgcccgctttggcgatcccgaggcgatgaataccctgcccgtgatgaacacg
gatttcctcgacgtactggtcgccgcccgcgagggcgaggacctgccccaactctcgttc
gccccgcgcgcgacggtctgtaagtacgccgtccccgagggctaccccgacgacccgcag
ggaggtaccccgatcgaggtcgacgaggagaccgtggcacaggcagcgagcgccacggtg
gaaacgaacggcgacgcccggctgttttacgccagcgtggacagcagggacgacggggtc
tacaccaccacctcgcgggcgttcgcggtcgtggggatcgcagaaaccatctccgaggcc
gaggggatcgccgagcgcgccctctcgaacgctgacgagggcgttcggatccgccacgac
atcggcaccgaggagctagtgcaatctcgcatcgaccacgcggccgaactgcgcggcgag
tag

DBGET integrated database retrieval system