KEGG   Halalkalicoccus jeotgali: HacjB3_07880Help
Entry
HacjB3_07880      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TANGO2
Motif
Other DBs
NCBI-ProteinID: ADJ14961
UniProt: D8J2K4
Position
complement(1460515..1461252)
Genome map
AA seq 245 aa AA seqDB search
MCTLIFAWQVFEDAPVLIAANRDEALGRPSHPPGLYSETPRIVAPWDEEAGGTWIGSNEH
GVAAVVTNRWLDTELAAERSRGLLVGEALERESAEDAARFVEHSVREFEYDGFNLALIDA
NAAILLEWNGGLRVRNFDPGVHVVVNVGADGDFEIPAERAEFAERQAESARRAREVLRPD
PGERPREWHERAVAVLQDHEYTFCVHADEYGTRSSSLIRVNADGTTEYRFADGPPCETAY
EPIDT
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtacgctcatcttcgcgtggcaggtcttcgaggacgcccccgtactgatcgcggcg
aacagggacgaagcgctcggccggccctcccacccaccgggtctgtacagcgaaacccca
cgaatcgtcgccccgtgggacgaggaggccggcgggacgtggatcggctccaacgaacac
ggggtggccgccgtcgttacgaaccggtggctggataccgaactggccgccgagcgctcc
cgtggcctgctggtcggcgaggcgctcgaacgagaatcggcggaggacgccgcccggttc
gtcgagcattcagtgagagagttcgagtacgacgggttcaacctcgcgctgatcgacgcg
aacgccgcgatcttgctggagtggaacggcgggcttcgcgtcaggaacttcgatcccggc
gttcacgtcgtcgtcaacgtcggcgccgacggcgacttcgaaatccccgctgaacgggcc
gagttcgcggaacgacaggcagaaagcgcccggcgggcacgcgaggtgctccggcccgac
cccggcgagcgcccccgcgagtggcacgagcgggcggttgctgtgctgcaagaccacgag
tacaccttctgtgttcacgccgacgagtacggcacgcgctcctcgtcgctgatccgcgtg
aacgcggacggcactaccgagtaccggttcgccgacggcccgccctgcgagacggcttac
gaacccatcgacacctaa

DBGET integrated database retrieval system