KEGG   Halalkalicoccus jeotgali: HacjB3_07890Help
Entry
HacjB3_07890      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
  KO
K06888  uncharacterized protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredox_DsbH Thioredoxin_7 GlcNAc_2-epim
Motif
Other DBs
NCBI-ProteinID: ADJ14963
UniProt: D8J2K6
Position
1461636..1463765
Genome map
AA seq 709 aa AA seqDB search
MNTDRNRLDEEASPYLRQHADNPVNWQPWDDAALAEAEERDVPIFLSVGYSACHWCHVME
EESFEDEDIAKQLNENFVPIKVDREERPDLDSIYQTICQLVTRRGGWPLSVWLTPDGRPF
YVGTYFPRESRRGTPGFGDLLGNLAESWEGDREEIENRADQWTRAITDQLEEVPEAGERP
EGVLIEAADAALRGADREHGGFGQNGPKFPQTARLEVLLRAYDRTGRGPYDEVVRETLDA
MGSRGMYDQLGGGFHRYATDREWVVPHFEKMLYDNAELPRSYLAGYRVTGQERYARIVRE
TLAFVERELGHPDGGFYSTLDAQSEDPETGEREEGAFYVWTPAAVEEVLDEERAALFCER
YGVDKRGNFEGKTVLTLARSVGSLAEEYGLDEDEVEDRLVEAERRLFEAREERPRPRRDE
KVLAGWNGLMISSFAEAGLTLDGSYAKRAAEALEFVREQLWDTEGKRLSRRFKDREVKID
GYLEDYAFLARGAFDTYQATGDVEHLKFALDLARAIEREFWDEERETLYFTPEAGEELVA
RPQELNDQSTPSSLGVACDVLLSLSQFADADFEGIVERVLARHGDRIRGNPLEHATLALV
ADRFENGSLEVTVAADVLPTEWRERLGEAYLPGRVLARRPPTEEGLEGWLDELGLEEAPP
IWADREAREGEATAYVCRSFTCSPPVTDIEEALEWADELDPATPTAESS
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgaacacagaccggaaccggctcgacgaggaggcgagcccgtatctccgacagcacgcc
gacaacccggtgaactggcagccctgggacgacgcggccctcgcggaggccgaggagcgc
gacgtgccgatcttcctctcggtggggtactcggcgtgtcactggtgtcacgtcatggaa
gaggagagcttcgaggacgaagacatagcgaagcagctcaacgagaacttcgtcccgatc
aaagtcgatcgggaagaacggccggatctcgacagcatctaccagacgatctgccagctg
gtcacccgcaggggagggtggcctctctccgtatggctcacccccgacggccggcccttc
tacgtcgggacgtacttcccacgggaatcgcgccgtgggacgccgggctttggcgacctc
ctcggaaacctcgccgagagctgggagggggaccgcgaggaaatcgagaaccgcgccgat
caatggacccgggcgatcacggaccaactggaggaggttcctgaggcgggcgagcgcccc
gaaggggtcctgatcgaggccgcggacgccgccctccggggtgcggatcgcgaacacggt
gggttcggccaaaacggcccgaagttcccccagaccgcccgattggaagtactcctccga
gcgtacgaccgcacggggcgcgggccgtacgacgaggtcgttcgcgagacactcgacgcg
atgggtagtagaggaatgtacgaccagctcggcggcggctttcaccggtatgcgaccgac
cgcgagtgggtcgtcccgcacttcgagaagatgctctacgacaacgccgagcttccccgg
agctacctcgcgggctaccgggtcaccggccaggagcggtacgcacggatcgtccgcgag
acgctcgcgttcgtcgagcgcgaactcgggcatcctgacggcgggttttacagcacgctc
gacgcccagagcgaggaccccgaaacgggcgagcgcgaggagggtgcgttctacgtctgg
acgcccgcggcggtcgaggaagtcctcgacgaggagcgcgcggcgctgttctgcgagcgg
tacggcgtcgacaagcgggggaacttcgaggggaaaacggtgctgacgctcgcccggagc
gtggggtcgctggccgaggagtacgggctcgatgaggacgaggtcgaagaccggctggtc
gaggccgagcggaggctgttcgaggcccgcgaggaacgcccgcgaccgcgccgcgacgag
aaggtgctcgcgggctggaacggcctgatgatctcgtcgttcgcggaggccgggctaaca
ctggacggctcatacgcgaagcgagccgccgaggcgctcgaattcgttcgcgaacagctc
tgggacacggagggaaagcggctctcgcggcgtttcaaggaccgagaggtgaagatcgac
ggctatctcgaggactacgcattcctcgcacgcggcgcgttcgatacgtaccaggccacc
ggcgacgtcgaacacctgaagttcgccctcgatctggcgcgggcgatcgagcgggagttc
tgggacgaggagcgcgaaacgctgtacttcacgcccgaggcgggcgaggagctcgtcgcc
cggccccaggagttgaacgaccagtcgacgccgtcgagtctgggcgtcgcctgtgacgtg
ttgctgtcgctgtcgcagttcgccgacgccgatttcgaggggatcgtcgagcgggtgctc
gccagacacggcgaccggatccgagggaacccgctcgaacacgcgacgctcgcgctggtc
gccgaccgcttcgagaacggctcgctcgaggtgacggtcgccgctgatgtgcttccgacg
gagtggcgcgaacggctgggcgaagcgtacctcccggggcgggtcctcgcgcgacggccg
ccgaccgaggagggcttggaagggtggctcgacgaactcgggctggaagaagcgccaccg
atctgggcggatcgcgaggcccgcgagggcgaggcgaccgcctacgtctgtcgctcgttt
acctgctcgccgccggtcacggatatcgaggaggccctggagtgggccgacgagctcgat
ccggcgaccccaacagcggagtcgagttag

DBGET integrated database retrieval system