KEGG   Halalkalicoccus jeotgali: HacjB3_07900Help
Entry
HacjB3_07900      CDS       T01271                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 LacY_symp ERG4_ERG24
Motif
Other DBs
NCBI-ProteinID: ADJ14965
UniProt: D8J2K8
Position
complement(1464190..1465362)
Genome map
AA seq 390 aa AA seqDB search
MRDLWSDGRGWILLGVAGGWFLSLGVRLVFPALLPYIREAFSLGLTTAGLLITVLWVAYA
LGQFPGGIIGDRLGEGNALVVSTLVSGTTIAVVAVANTALVLFLATALFGFSTALFGPAR
FTILSTIYDERDGTAIGLTLAVGEAGNAILPVVAGVLAAVASWRLGFGVTVPLFFLMAIV
LYRVVPGKLSEGSAVDSLSVGTLKYVASGIAERSILIVTGVHVFLFFVYQGFTGFYPTYL
VEMKGLSPGLAAGLFGLFFASGVAVQPIAGASGDRFGTRPTLYVVIAITTLALGTLPFVE
GFVGLVVVTVVASALLGVTPLTQTFLVNALPEDMKGSGLGLLRTGHIALGATGPLVVGAV
ADLNYFDGAFLGLAVLSAAGIVLTALVPDD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgatctctggagcgacggccggggatggatcctgctcggcgtcgccggcggctgg
ttcctctcgctcggcgtccgcctcgtctttcccgcgctcctcccgtatatacgggaggcc
ttctcgctcgggctgaccaccgcgggcctgctgatcaccgtcctgtgggtcgcctacgcg
ctcggacagttccccggcgggatcatcggggatcgcctcggtgagggcaacgcgctggtg
gtcagcaccctcgtctcggggacgaccatcgcggtcgtcgcggtcgcgaacacggccctc
gtcctctttctcgcgaccgcgctctttggcttctcgacggcgctgtttggccccgcccgc
tttacgatcctctctacgatctacgacgagcgcgacggcaccgccatcggcctgacgctc
gcggtcggggaggcgggcaacgccatcctacccgtcgtcgccggcgtgctcgccgcggtc
gcctcgtggcgactcggcttcggcgtgacagtgccgctctttttcctgatggcgatcgtc
ctctatcgggtcgttccggggaaactctcggagggcagcgcggtcgatagcctctcggtc
gggacgttgaagtacgtcgcaagcgggatcgcggaacgctcgatcctgatcgtcaccggc
gtccacgtcttcctctttttcgtctatcagggttttacgggcttttatcccacgtacctc
gtcgagatgaagggcctctcgccgggcctcgccgccgggctgttcggcctgtttttcgcg
agcggcgtcgcggtccagccaattgcaggcgcgagcggcgaccgtttcggcacccgcccg
acgctgtacgtcgtcatcgccatcacgacgctcgcactcggcaccctccccttcgtcgag
ggctttgtaggcctcgtcgtcgtcacggtcgttgcgagcgctctcttgggagtaacgccg
ctgacccagacgttcctcgtcaacgcgctgccagaggacatgaaaggcagcgggctcggc
ctgctcaggaccggtcacatcgcactcggggcgacggggccgctcgtcgtcggtgcggtc
gcggatctgaactacttcgacggcgcctttctcgggctcgcggtcctctcggcggcgggg
atcgtgttgacggcgctcgtccccgacgactga

DBGET integrated database retrieval system