KEGG   Halalkalicoccus jeotgali: HacjB3_07965Help
Entry
HacjB3_07965      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADJ14978
UniProt: D8J2M1
Position
1475128..1475961
Genome map
AA seq 277 aa AA seqDB search
MFGVVTRNREECTWPEFDLAFYESKDVSGRSTEPVPEAVTMISCFGDNAAAESSPELVPR
NREGELATRERPYFDWAYICPTHEGYREGLLEMVGEATDVTENVRLDDVGFPRREYCFCE
RCTRLFEESEFEDRLAWRASVITEFVADAAERIPGKTYLTLYPDPYPGHLYERAGLDIEA
IEPHVDEFVIPLYDMAYTTTYWLETIASGFESLLDTPFSVELYAVDVEIDNLIHAAEVAD
AYGEDVFFGYDAANAQAALRRMRADTREGKSYGPDST
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttcggggtcgtcacgcgcaaccgggaggagtgtacctggcccgagttcgatctcgcc
ttctacgagtcgaaggacgtcagcggacgctcgacggagccggtccccgaggccgtcacc
atgatttcctgtttcggcgacaacgccgccgccgagagctctccggaactcgtcccgcgg
aaccgggagggcgaactcgcgacccgcgaacggccctacttcgactgggcgtacatctgc
ccgacccacgagggctaccgggagggactcctcgaaatggtgggcgaagccacagacgtc
accgagaacgtccgcctcgacgacgtgggctttccccgtcgggagtactgtttctgcgag
cgctgtacccgactgttcgaggaaagcgagttcgaggaccgcctcgcgtggcgcgcgtcg
gtcatcaccgagttcgtcgccgacgccgcagagcggatccccgggaagacctacctgacg
ctgtatcccgacccgtatccgggccacctctacgagcgcgccggactcgacattgaggcg
atcgaaccccacgtcgacgagttcgtgatcccgctgtacgacatggcctacaccaccacc
tactggctcgaaaccatcgcaagcggtttcgagagcctgctcgataccccctttagcgtc
gaactgtacgcggtcgacgtcgagatcgataacctgatccacgccgcggaagtcgcagac
gcctacggcgaggacgtcttcttcggctacgacgccgcaaacgcccaggccgcactgcgg
cggatgcgtgcggatacccgcgagggcaagagttacggaccggactcgacgtag

DBGET integrated database retrieval system