KEGG   Halalkalicoccus jeotgali: HacjB3_07975Help
Entry
HacjB3_07975      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LBR_tudor DUF1918
Motif
Other DBs
NCBI-ProteinID: ADJ14980
UniProt: D8J2M3
Position
1476652..1476849
Genome map
AA seq 65 aa AA seqDB search
MSFDEDDRVVLSDDHSEFDGQEGRITQVMDTMFGDATYTVSFEDGQETGIPESDLSAADD
TETEE
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgacgaggacgaccgcgtcgtgctgtcggacgaccacagcgagttcgacggc
caggagggacggatcacgcaggtgatggacacgatgttcggcgacgccacctacaccgtg
agcttcgaggacggccaggagaccggcatccccgaatccgacctctcggcggccgacgac
accgagacagaggagtaa

DBGET integrated database retrieval system