KEGG   Halalkalicoccus jeotgali: HacjB3_07980Help
Entry
HacjB3_07980      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
  KO
K07581  RNA-binding protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_binding
Motif
Other DBs
NCBI-ProteinID: ADJ14981
UniProt: D8J2M4
Position
1476856..1477272
Genome map
AA seq 138 aa AA seqDB search
MAAVPLHYVDLRTFCYATEDEKRVEEALRTYLPEGFEIERAETEGYHGDRILVLSARVEN
ADGIRHVLEQLRGSADLEQVRGQLDDRVTENCELFLYLDKQAAFGGEARLGEGITLRAKV
EAYPAKKDTAIENVREVL
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtcccgcttcactacgtcgacctccgaaccttctgttatgcaaccgaggac
gaaaagcgggtcgaggaggccctgcggacctacttgcccgagggcttcgaaatagaacgt
gccgagaccgagggctatcacggcgaccgcatcctcgtcctctcggcgcgcgtcgagaac
gccgacggcatccgccacgtcctcgagcagttgcgcgggtcggcggacttagaacaggtg
cgtggacaactcgacgaccgggtgaccgagaactgcgagctgttcctctatctcgacaag
caggccgccttcggcggcgaggcccgactcggcgaggggatcaccctgcgcgcgaaggtc
gaggcctacccagcgaaaaaggacacggcgatcgagaacgtccgcgaggtcctgtag

DBGET integrated database retrieval system