KEGG   Halalkalicoccus jeotgali: HacjB3_08040Help
Entry
HacjB3_08040      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ
Motif
Other DBs
NCBI-ProteinID: ADJ14993
UniProt: D8J2N6
Position
1487898..1488374
Genome map
AA seq 158 aa AA seqDB search
METLYDVLGVDPNADAAAIRAAYREGAKRHHPDAADGDAATFRRLTTARDVLLDERRRER
YDSLGHRRYARHHLGEERPAGESTRGRRQHAEFDRSSRQTSRPRRGRPARPDRREGARRG
GTTDGRVAVSTYWPVMRRAGLVLGALLVVAFVLAALSL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggagacgctgtacgacgttctcggggtcgatccgaacgccgatgcggcggcgatccgt
gccgcgtaccgcgagggggcgaaacgccaccaccccgacgctgccgacggcgacgcggcg
acgttccgtcggctcacgaccgcgcgcgacgtgttgctcgacgaacgccgtcgggagcgc
tacgattcactcggccaccgccggtacgcccggcaccatctgggcgaggagcggccggcc
ggggagtcgacgcgcggacggcgtcaacacgccgagttcgaccggtcgagccgtcagacg
agtcgcccacgccggggtcgccccgcccggcccgatcgccgcgagggcgctcgtcgaggg
gggacgaccgacggccgcgtcgcggtctcgacgtactggccggtgatgagacgtgcgggt
ctcgtcctcggagcgctcctcgtggtggcgttcgtcctcgcggcactgtcgctttaa

DBGET integrated database retrieval system