KEGG   Halalkalicoccus jeotgali: HacjB3_08175Help
Entry
HacjB3_08175      CDS       T01271                                 

Definition
(GenBank) response regulator receiver protein
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje02020  Two-component system
hje02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hje00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HacjB3_08175
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    HacjB3_08175
Two-component system [BR:hje02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   HacjB3_08175
Bacterial motility proteins [BR:hje02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    HacjB3_08175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: ADJ15018
UniProt: D8J2R1
Position
complement(1511360..1511722)
Genome map
AA seq 120 aa AA seqDB search
MSTRVLIVDDSEFMRSLLREILAEDYEIVGEAENGVEAVELYEEHDPDLVMMDIVMPIRD
GIEATTAITAGDADARVIMCTSVGQEEKMKMAVKAGASGYITKPFQKPSVLQAIDDVVPA
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacgcgtcctgatcgtcgacgactcggagttcatgcgcagcctcctgcgagag
atcctcgccgaggactacgagatcgtcggtgaagccgaaaacggcgtcgaggccgtcgaa
ctgtacgaggaacacgatcccgatctggtgatgatggacatcgtcatgccgatccgcgat
gggatcgaggcgacgacggcgatcaccgccggggatgccgacgctcgggtgatcatgtgt
acgagcgtgggccaggaggagaagatgaagatggcggtcaaagccggcgcgagcggctac
atcaccaaaccgttccagaaaccgagcgtcctccaggccattgacgacgtcgtgcccgca
tag

DBGET integrated database retrieval system