KEGG   Halalkalicoccus jeotgali: HacjB3_08200Help
Entry
HacjB3_08200      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADJ15023
UniProt: D8J2R6
Position
1514640..1514738
Genome map
AA seq 32 aa AA seqDB search
MEFETEGYDVSVEDRANVTNKLDEVWRSVSSS
NT seq 99 nt NT seq  +upstreamnt  +downstreamnt
gtggagttcgaaacggaggggtacgacgtgtccgtcgaggaccgggcgaacgtgacgaac
aagctggatgaggtctggcggtcggtttcgagttcctga

DBGET integrated database retrieval system