KEGG   Halalkalicoccus jeotgali: HacjB3_08380Help
Entry
HacjB3_08380      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0058 Ada3 T7SS_ESX_EspC
Motif
Other DBs
NCBI-ProteinID: ADJ15059
UniProt: D8J2V2
Position
1545636..1545914
Genome map
AA seq 92 aa AA seqDB search
MHKDELLELHDQMVSIMEYFKRQEDVDEELFAPYEQLDVDPSHVHKSKSEHKHAVFVLGN
ALANAMSNDEFSSAGRIGKRMAELADDAERKI
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaggacgaacttctggagcttcacgatcagatggtctccatcatggagtacttc
aaacgacaggaggatgtcgacgaggaactcttcgccccctacgaacagctcgacgtcgac
ccctcgcacgttcacaagtccaaaagcgagcacaaacacgccgtgttcgtcctgggcaac
gcgctcgcgaacgccatgagcaacgacgagttctccagtgccggccggatcggcaagcgc
atggccgaactcgccgacgacgccgagcgaaagatttaa

DBGET integrated database retrieval system