KEGG   Halalkalicoccus jeotgali: HacjB3_08390Help
Entry
HacjB3_08390      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_12 HTH_24 HTH_5 TrmB Phage_rep_org_N DUF977
Motif
Other DBs
NCBI-ProteinID: ADJ15061
UniProt: D8J2V4
Position
complement(1547816..1548121)
Genome map
AA seq 101 aa AA seqDB search
MIDRLEKEVDMLERHLQVLKMVIENEPIGIVKMSNETGYPHHKVRYSLRVLEEENLIEPS
SQGAITTERTEEFVADLDDKLAETIGTLEGMKIEGVAEVES
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgatagaccggcttgagaaagaagtcgatatgctggaacggcacctccaggtcctgaag
atggtcatcgagaacgaacccatcgggatcgtgaagatgtcgaacgaaaccggctacccc
caccacaaagtccgctactcgcttcgcgtcctcgaggaggagaacctcatcgaaccctcc
agtcagggagcgatcactaccgagcgcaccgaggagttcgtcgccgatctcgacgacaaa
ctcgcggagacgatcggcaccctcgaagggatgaaaatcgagggcgtcgccgaagtcgaa
agctag

DBGET integrated database retrieval system