KEGG   Halalkalicoccus jeotgali: HacjB3_09170Help
Entry
HacjB3_09170      CDS       T01271                                 

Definition
(GenBank) hypothetical protein
Organism
hje  Halalkalicoccus jeotgali
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1697964..1699019
Genome map
AA seq 351 aa AA seqDB search
MDDRQRELLEDLLATPSPSGFETDGQRTWIDAVSEVADEVRTDDYGNAVATIEGGPTEIA
VVGHADQIGYIVRRIDDDGFLHLGAIGGVDKTVSRGQYVTVHADSGSIPGVIGQTAIHLR
EGDEEYDEIADLKADIGAEDGESARELVSVGDPITVESRQRDLQGSRLAATGLDNRVGTW
TAAETLRAAAESGVGPTVHAVSTVQEELGVRGARMVGFDLAPDAAIAVDVTHASDGADAP
ASRGGDLDLGAGPVIGRGSANHPALVDALREAASEAGIGVQLEALGTATGTDADAFYTAR
GGIPSLNLGIPNRYMHTPVEVVDTEDLRGSVALLVAFLENAAGDERFAVEL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccgtcagcgcgagttactcgaagacctcctcgcgaccccctcgccatccggg
ttcgaaaccgacggccagcgcacctggatcgatgccgtcagtgaggtcgccgacgaggta
cggaccgacgactacggtaacgccgtcgcgaccatagagggcggtccgaccgagatcgcg
gtcgtcggccacgccgaccagatcggctacatcgtccgccggatcgacgacgacggattc
ctccacctcggggcgatcggcggcgtcgataagaccgtctcgcggggtcagtacgtcaca
gtccacgccgactcgggatccatcccgggcgtgatcggtcagaccgcgatccatctgcgc
gagggcgacgaggagtacgacgagatcgccgacctgaaggccgacatcggggccgaggac
ggcgagtctgcccgcgaactcgtttccgtaggtgatcccatcaccgtcgagagccgacaa
cgggatctccaggggagccggctggccgcgaccggactggataaccgcgtcgggacgtgg
accgccgccgaaaccctgcgggcggccgccgagtccggggtcggcccgaccgtccacgcc
gtgagcacggtccaggaggaactcggggtccggggtgcgcgcatggtcgggttcgacctg
gcgcccgacgccgccatcgcggtcgacgtgacccacgcgagcgacggcgcggacgcgccc
gcgagccgagggggcgacctcgatctgggcgcgggcccggtgatcggacgggggagcgcg
aaccacccggcgctggtcgacgctctgagggaggccgcaagcgaggcggggatcggggta
cagctagaggctctcgggaccgcgaccggtaccgatgccgacgccttttacaccgcccgc
ggtgggatcccctcactcaacctcggaatcccgaaccggtacatgcacacgccggtcgaa
gtcgtggacaccgaggacctgcgcgggtcggtcgccctgctcgtggcgttcctcgagaac
gcggccggggacgagcgcttcgccgttgaactctaa

DBGET integrated database retrieval system