KEGG   Halalkalicoccus jeotgali: HacjB3_09660Help
Entry
HacjB3_09660      CDS       T01271                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00010  Glycolysis / Gluconeogenesis
hje00071  Fatty acid degradation
hje00350  Tyrosine metabolism
hje00625  Chloroalkane and chloroalkene degradation
hje00626  Naphthalene degradation
hje01100  Metabolic pathways
hje01110  Biosynthesis of secondary metabolites
hje01120  Microbial metabolism in diverse environments
hje01130  Biosynthesis of antibiotics
hje01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HacjB3_09660
  Lipid metabolism
   00071 Fatty acid degradation
    HacjB3_09660
  Amino acid metabolism
   00350 Tyrosine metabolism
    HacjB3_09660
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HacjB3_09660
   00626 Naphthalene degradation
    HacjB3_09660
Enzymes [BR:hje01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HacjB3_09660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ADJ15315
UniProt: D8J3K8
Position
1789216..1790268
Genome map
AA seq 350 aa AA seqDB search
MQAVVLESHGDPLALRDVPEPDLEPDGVIVDVEACGICRSDWHAWKGHGEWVDDVPPEGQ
ILGHEPAGTVLEVGDRIETLEEGDRVAVPFSLGDGTCSRCRNGHGNVCPNGTALGFEPAG
QGAFADRIAVPHADYNLTTLPEGVSASAAAALGCRYMTAYHGLAHRADLAPGDWVAVHGC
GGVGLSAVQIANALGARVLAVDVRSAPLEKATELGAHETVHGGGDVPGKIRELTGGGAAI
SIDALGISETCRNSVACLASLGQHLQLGLTTDAERGEVSLPTDSMVGREIDFLGSRGMPP
TRYDELLGFVESGAIDPGALVSHKVPLAEVPERIAAMDEFSAVGIEVYER
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagtcgttctcgaatcacacggtgacccgctcgcgctgcgtgacgttccggag
cccgacctcgaacccgacggcgtgatcgtcgacgtcgaggcctgcgggatctgtcgctcg
gactggcacgcctggaagggccacggcgagtgggtcgacgacgtcccccccgaggggcag
atcctcgggcacgaacccgccgggaccgtcctcgaggtgggcgatcgaatcgaaaccctc
gaagagggcgatcgggtcgccgtcccgttcagcctcggggacggcacctgctcgcggtgt
cgaaacggccacgggaacgtctgtcccaatggaacggctctcgggttcgagcccgccggt
cagggcgcgttcgccgaccggatcgcggtgccacacgccgactacaacctcacgacgctc
ccggagggggtctctgcgagcgcggccgccgcgctcggctgtcggtacatgaccgcctat
cacgggctggcccaccgcgccgacctcgcccccggcgactgggttgcggtccacggctgt
ggcggggtcggcctctcggcggtccagatcgcgaacgcactcggcgcgcgcgtcctcgcc
gtcgacgttcggtcggcgcccctcgaaaaggccaccgaactgggtgcccacgagacggtc
cacggcgggggtgacgtccccgggaagatccgcgagctgacgggtggcggggcggcgatc
tcgatcgacgcgttgggtatctctgagacctgtcgcaactccgtggcctgcctcgccagc
ctcggccaacacctccagctggggttgacgaccgatgccgagcgcggcgaggtttccctg
ccgaccgactcgatggtcggccgagagatcgacttcctcggttcgcgcgggatgcctccg
acccgttacgacgaactgctggggttcgtcgaaagcggcgcgatcgaccccggtgcgctc
gtgagccacaaggtcccgctcgcggaggtccccgagcggatcgccgcgatggacgagttc
agtgcggtcgggatcgaagtctacgagcgctag

DBGET integrated database retrieval system