KEGG   Halalkalicoccus jeotgali: HacjB3_10670Help
Entry
HacjB3_10670      CDS       T01271                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hje00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1987252..1988787
Genome map
AA seq 511 aa AA seqDB search
MTTEHFVGAIDQGTTGTRFMMFDHGGQVIANAYETHEQIYPEPGWVEHDPNEIWRNTQSV
MTDALSNAGLEAEQLAAIGVTNQRETTLLWDADTGQPIHNALVWQDRRTTDRVEELQEAG
MAETIREKTGLEVDAYFSATKAEWILDNADPIKTQRARPADLRERAADGEIKFGTIDTWL
IEKLTGNHITDVTNASRTMLYDIHEGDWDEELLDEFGIAREMLPEVRPSSDENHYGTTDP
DDFLGAEVPVAGALGDQQAALFGQTCFDPGDAKNTYGTGSFFLMNTGEEAVESEHGLLTT
VGFQRSGEPIQYALEGSIFITGAAIEWLVDVELIEDPAETESLARSVDSTDGVYLVPAFT
GLGAPHWDGRARGTIVGMTRGTTKEHIVRATLESIAYQTRDVAEAMEADSGIEMSSLRVD
GGAVKNNFLCQLQADSIGSEIVRPVVDETTALGSAYAAGLAVGYWETADELRDNWQVDRE
FAPEMASTEADRKYGRWQEAVERSLNWAQEE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaacacttcgtcggcgcgatcgatcagggaacgacaggaacgcgattcatg
atgttcgatcacggcgggcaggtgatcgcgaacgcctacgagacccacgagcagatctat
cccgaaccgggctgggtcgaacacgaccccaacgagatctggcgcaacacccagtcggtg
atgaccgacgcgctctcgaacgcggggcttgaggccgagcaactggccgccatcggcgtc
accaaccagcgcgagacgacgctgttgtgggatgccgatacgggccagccgatccacaac
gcgctggtctggcaggaccgccggacgaccgatagggtcgaggagcttcaggaggcgggg
atggcagaaaccatccgcgagaagaccggactggaggtcgacgcctacttctcggcgacg
aaagccgagtggatcctcgacaacgccgatccgatcaagacccagcgcgcccggcccgcg
gacttacgcgagcgcgccgccgacggggagatcaagttcggcacgatcgacacctggctc
atcgagaaactgacgggcaaccacatcaccgacgtcacgaacgcctcgcggacgatgctc
tatgacatccacgagggcgactgggacgaggagttgctggacgagttcggcatcgcccgg
gagatgctcccggaagtacggccctccagcgacgagaaccactacgggacgaccgatccc
gacgacttcctcggcgcggaggtccccgttgcgggcgcactcggcgaccagcaggccgcg
ctgttcggccagacgtgtttcgaccccggcgacgcgaaaaacacctacggaacggggtcg
ttcttcctgatgaacaccggcgaggaggccgtcgagagcgaacacggcctcctgacgacc
gtcggcttccagcgctcgggcgagccgatccagtatgcgctcgaagggtcgatcttcatc
accggcgcggccatcgagtggctcgtcgacgtggagttgatcgaggaccccgccgagacc
gagtcgctggcccgtagcgtcgactcgacggacggcgtctacctcgtgcccgccttcacc
gggttgggagcgccccactgggacggccgggcgcgcgggaccatcgtcgggatgacccgc
ggcaccacgaaagaacacatcgtccgtgcgaccctcgaatcgatcgcctaccagacgcgg
gacgtcgccgaggcgatggaggccgactcgggcatcgaaatgagcagtctgcgcgttgac
ggcggcgcggtcaagaacaacttcctctgtcaactgcaggccgatagcatcggctcggag
atcgtccggcccgtggtcgacgagacgacggcactcggctcggcgtacgccgccggactc
gcggtgggctactgggagaccgccgacgaactgcgggacaactggcaggtcgaccgggag
ttcgccccggagatggcgagtacggaggccgaccgcaagtacggacgctggcaggaggcc
gtcgaacgatcgctgaactgggcacaggaggagtaa

DBGET integrated database retrieval system