KEGG   Halalkalicoccus jeotgali: HacjB3_11075Help
Entry
HacjB3_11075      CDS       T01271                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HacjB3_11075
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HacjB3_11075
Enzymes [BR:hje01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HacjB3_11075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2059273..2060181
Genome map
AA seq 302 aa AA seqDB search
MNERVRVIGAPLDYGADRRGVDMGPSAIRYAGLAGELAASGRTAVDRGDLSVPRAEERDP
DAETPVRGSAKFLREVRDVCERLSEAVEDTLAAGEFPLVLGGDHSIAIGSIQGSSRNADV
GVIWFDAHGDFNTPETSPSGNVHGMPMAAALGHGSFAGTDWANAPGVDPENVVLVGLRSL
DEKERLAIRESPVTAYTMSDIDERGITAVTEEALEVAGSAADGIHVSLDMDWLDPKEAPG
VGTPVRGGVTYREAHAALEIVANRKVLRSLEVVEVNPILDSGNETASLAVELAASALGKR
IL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacgggtcagagtcatcggtgcgcccctcgattacggtgccgaccgccggggc
gtggatatgggaccgtcggccataagatacgcgggactcgccggggagctcgccgcgagc
ggccggaccgccgtcgaccggggcgatctgagcgtcccccgggccgaggaacgcgatccg
gacgccgagacgcccgtacgcgggtcggcgaagttcctccgcgaggtccgggacgtctgc
gagcggctctcggaagccgtcgaggacaccctcgcggcgggggagttcccgctcgtgttg
gggggcgatcactcgatcgcgatcggctccatacaggggtcgagccggaacgcagacgtc
ggtgtgatctggttcgacgcccacggcgatttcaacacgcccgagacgtcccccagcggc
aacgttcacgggatgccgatggccgccgcgctcggccacggttcctttgccggcactgac
tgggccaacgcccccggggtcgatcccgagaacgtcgtgctcgtcgggcttcgaagtctc
gacgagaaagaacgcctcgcgatccgcgagagccccgtgaccgcctacacgatgtccgac
atcgacgagcgcggcatcacggccgtcaccgaggaggcactcgaggtcgcgggcagcgcc
gccgacgggatccacgtcagcctcgatatggactggctcgatcccaaggaagcgcccggc
gtcggcacgcccgtccgcggtggcgtgacctaccgggaggcccacgccgccctcgagatc
gtcgccaaccgcaaagtgcttcgctcgctcgaggtcgtcgaggtcaacccgatcctcgat
tcgggcaacgaaacggcaagtctggcggtcgaactcgccgcgagcgcactgggaaaacgc
attctgtag

DBGET integrated database retrieval system