KEGG   Halalkalicoccus jeotgali: HacjB3_11275Help
Entry
HacjB3_11275      CDS       T01271                                 

Definition
(RefSeq) acyl-CoA synthetase I 4
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HacjB3_11275
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HacjB3_11275
   00620 Pyruvate metabolism
    HacjB3_11275
   00640 Propanoate metabolism
    HacjB3_11275
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HacjB3_11275
   00680 Methane metabolism
    HacjB3_11275
Enzymes [BR:hje01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HacjB3_11275
Lipid biosynthesis proteins [BR:hje01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HacjB3_11275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2088849..2090834
Genome map
AA seq 661 aa AA seqDB search
MEGDNEDVQLEARLAEQDTFEPPESFTEQANVSDPEIYEEFEGNWPECWEQAADLLDWDE
SYDQVLNEDNAPFYEWFCEGKLNASYNCIDRHIEDGRGEEVAIEWVGEPVDETRTYTYQD
LYEEVNQTAAAFREMGVGEDDVVTMYLPMIPELAIAMLACARIGAPHSVVFAGFSADALA
TRMKSADSEYLVTCDGYYRRGDPLDHLDKANEGLADVDHDTTTVVVDRLGEEGFDHDLGE
DQVDYADLIADHEGAEIEPVVRDAEDMLFLMYTSGTTGQPKGVKHTTGGYLAYAAWTTHA
VLDVKPEDTYWCSADIGWITGHSYIVYGPLALGTTSVMYEGTPDYPEKDRMWEIVEDYDV
NQLYTAPTAIRAFMKWGQQYPDEHDLSSLRLLGTVGEPINPRAWKWYYKHIGGEECPVVD
TWWQTETGGMMITTLPGIGTMKPGSAGPPLPGIDARIVDTNGERIQAGQAGYLTVDKPWP
GMLRTLYKNDDRFISEYWQEYSDPDSNEWVYFPEDGAKIDDDDYITVLGRVDDVINVSGH
RLGTMEIESAIVGVSGVAEAAVVGGDHEMKGEAVYAYVITEDGYEGDEDLREEIVAGVED
AIGPIARPEAVVFTDELPKTRSGKIMRRLLEDIANEEELGDTSTLRNPDVVSEIQQKVQS
D
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggagggtgacaacgaggacgttcaactcgaggcacggctcgccgaacaggacacgttt
gagccgccggagtcgttcaccgagcaggcgaacgtctccgatccggagatctacgaggag
ttcgaagggaactggcccgagtgttgggagcaggcggccgatctgctcgattgggacgaa
tcgtacgaccaggtactgaacgaagacaacgcgcccttttacgagtggttctgtgagggc
aaactcaacgcctcgtacaactgtatcgaccgccatatcgaggatggccgtggcgaggag
gtcgccatcgagtgggtcggtgaacccgtcgacgagacgcggacctacacctatcaggac
ctctacgaggaggtaaaccagaccgccgcagcgttccgtgagatgggcgtcggcgaggac
gacgtcgtgacgatgtacctcccgatgatccccgagctcgcgatcgcgatgctcgcgtgt
gcgcgcatcggtgccccccactcggtggtgttcgcgggcttttccgcggacgcgctcgcg
acccggatgaagtcggccgattcggagtacctcgtcacctgtgacggctactaccgccgg
ggcgacccgctcgaccacctcgacaaagcaaacgaggggctcgcggacgtcgatcacgac
accacgacggtcgtggtcgaccgtctcggcgaggaggggttcgatcacgatctgggcgag
gaccaggtcgactacgccgacctgatcgccgaccacgagggcgcggagatcgaacccgtt
gtccgggacgccgaggacatgctgtttctcatgtacacctccggcactaccggccaaccc
aagggggtcaaacacaccaccggcggttatctggcctacgccgcctggacgacccatgcg
gtgctcgacgtcaagcccgaggacacctactggtgttcggcggacatcggctggatcacc
ggccactcctacatcgtctacgggcccctcgccctcggcacgaccagcgtgatgtacgag
ggcacgcccgattatcccgagaaggaccggatgtgggagatcgtcgaggactacgacgtg
aatcagctctacaccgctcccacggcgattcgcgcgttcatgaagtggggccagcagtac
cccgatgagcacgacctctccagtctgcgcctgctcggcaccgtcggcgagccaatcaac
ccccgcgcctggaagtggtactacaaacacatcggcggcgaggaatgtccggtggtcgat
acgtggtggcagaccgagaccggcggcatgatgatcaccaccctcccgggtatcggaacg
atgaaacccggctcggcgggtccgcccctgccggggatcgacgcccggatcgtcgacacc
aacggcgagcggatccaggcgggacaggcgggctatctcaccgtggacaagccctggccc
ggtatgctgcggacgctctataagaacgacgaccggttcatcagcgagtactggcaggag
tactccgaccccgacagcaacgagtgggtttacttccccgaggacggcgcgaagatcgac
gacgacgactacatcacggtgctggggcgggtcgacgacgtgatcaacgtctcgggccac
cggttggggacgatggagatcgagagcgccatcgtcggcgtctccggcgtcgccgaggcc
gccgttgtcggcggcgaccacgagatgaaaggcgaggcggtctacgcctacgtcatcacc
gaggacggctacgagggcgacgaagacctacgcgaggagatcgttgcgggcgtcgaggac
gccatcggtccgatcgcccggcccgaggcggtcgtgttcaccgacgagttgccgaagacc
cgttcgggcaagatcatgcgccgtctgctcgaggacatcgccaacgaggaggaactgggc
gacacctcgacgcttcgcaaccccgacgtcgtaagcgagatccagcagaaggtacagagc
gactga

DBGET integrated database retrieval system