KEGG   Halalkalicoccus jeotgali: HacjB3_11620Help
Entry
HacjB3_11620      CDS       T01271                                 

Definition
acyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HacjB3_11620
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HacjB3_11620
   00620 Pyruvate metabolism
    HacjB3_11620
   00640 Propanoate metabolism
    HacjB3_11620
  Energy metabolism
   00680 Methane metabolism
    HacjB3_11620
Enzymes [BR:hje01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HacjB3_11620
Lipid biosynthesis proteins [BR:hje01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HacjB3_11620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2150009..2151637)
Genome map
AA seq 542 aa AA seqDB search
MADFEWDVPEEYNLPAVIESHGESFGDRVALEFRNEAGDRTERTYGDLRGDMNRFANALA
ERRIGKGDRVLLLLPRHPDVFAIQLGVLKRGALVVPCSSMLAPKDIEYRATDCEATGIVC
DASLLEMVEPVLEETPLETLVALDGDTSGDLDGGATFDAFEGDWASFTDLVAAEEGHHDG
PALGAADPMSINYTSGTTGQPKPVLHRHRWMRCFELVNGPYWWGITAEDDLEDELLWATT
GTGWAKWFWSPVGVGLTTGARQFVYGGAFDPERFLELLEEEGVTRLCAVPTQYRMFSQTD
LGAYDPALREAVSAGEPLNRDPIAAFEEAFGVTPRDGYGQTETVALVTNYPGIEVKPGSM
GKPAPGMGTTIIDPDEEREVEPGEIGEIAVPVDCPGIFDGYFERPDLDERTFAGEYYRTG
DLASRDEEGYFFFEGRADDIIISAGYRIGPFEVEDALIEHEAVTEAAAVASPHDERGNVV
KAYVVLADGYEGNEDLTEEIQAVVKSETAPYKYPRRIEYVTELPKTSSGKIRRIELRKRE
RA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
gtggcggacttcgagtgggacgttcccgaggagtacaacctcccggcggtgatcgaatcc
cacggcgagtcgttcggcgaccgggtcgcactcgagttccgcaacgaggccggagatcgg
accgaacgtacctacggcgacctgcgtggggacatgaaccggttcgcgaacgcgctcgcc
gagcgcaggatcggaaagggggatcgtgtgttgttgctccttccacgacaccccgacgtc
ttcgcgatccaactgggggtactgaaacgtggcgcgctcgtggtcccctgttcgtcgatg
ctcgccccgaaggacatcgagtatcgtgcgaccgactgcgaggcgacggggatcgtctgt
gacgcctcgctgctcgagatggtcgaacccgttctcgaggagacgcccctcgagacgctc
gtcgctctggacggcgatacgagcggcgacctcgacgggggcgcgaccttcgacgcgttc
gagggtgactgggcgtcgtttaccgacctcgtcgcggccgaagagggccaccacgacggg
cccgcactcggggccgcggacccgatgtcgatcaactacaccagcgggacgaccggccag
ccgaaacccgtcctccaccgccaccgctggatgcggtgtttcgaactcgtcaacggaccc
tactggtggggaatcacggccgaagacgacctcgaggacgaactcctgtgggcgaccacc
ggaaccgggtgggcgaagtggttctggagcccggtcggcgtcggtctgaccaccggcgcg
aggcagttcgtctatgggggcgcgttcgacccggagcgctttctcgaactcctcgaagag
gagggcgtcacacggctgtgtgcggttccgacgcagtaccggatgttctcgcagacggac
ctcggggcctacgaccccgcgctccgggaggcggtctcggcgggcgaaccgttgaaccgc
gatccgatcgcggccttcgaggaggccttcggcgtgacgccccgggacggctacgggcag
accgagacggtcgcgctcgtcaccaactaccccgggatcgaggtcaagcccgggagcatg
ggcaagccggcacctgggatggggacgacgatcatcgacccggacgaagagcgggaggtc
gaaccgggcgagatcggcgagatcgccgttccggtcgactgtccggggatcttcgacggc
tacttcgagcgcccggacctcgacgagcggacgttcgcgggcgagtactaccggaccggg
gatctggcctcccgtgacgaggagggctacttcttcttcgaggggcgggccgacgacatc
atcatctcggcgggctaccggatcggccccttcgaagtcgaggacgccctgatcgaacac
gaggcggtcacggaggccgccgcggtggcgagcccccacgacgagcggggcaatgtcgtc
aaggcctacgtcgtgttggccgacggctacgaggggaacgaggacctcaccgaggagatc
caggccgtcgtcaaatcggagacggccccctacaagtacccccgccggatcgagtacgtc
accgaactcccgaagacctcgagcgggaagatccgccggatcgaactccgaaagcgagaa
cgggcctga

DBGET integrated database retrieval system