KEGG   Halalkalicoccus jeotgali: HacjB3_11900Help
Entry
HacjB3_11900      CDS       T01271                                 

Definition
Cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hje00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2201978..2203036
Genome map
AA seq 352 aa AA seqDB search
MAVEPDFEYDLLERLTEARGVPGYEDRVRAIVREELTPHVEDLHTDAMGNVIGTVEGESA
YSVVVAAHMDEIGFMVTHVDENGFLAVDPLGGFDPRVLKAQRATVHTRGGDLPGVIGSAP
PHTLDEADREKTPKVEDVRIDLGLDAETVEERVSPGDLVTLDQGTEIVGEHVTGKAVDNR
VSVLALIEAARRLDSPAVTVHFAATVQEEVGLRGANALGVDLDPDLAIALDTTVANDVPG
FEEREYVTRCGEGVAIKLKDSSVITSPKVHRRLAAVAETEGISHQFEVLPAGGTDTAGFQ
TAAGAKPVGALSIPTRYLHTVTESAHLRDVGATIDLLSAFLDGETGEGDYRL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgaacccgacttcgagtacgacctactcgagcgcctgaccgaggcccgcggc
gttccgggctacgaggaccgcgtacgggcgatcgtccgcgaggaactcaccccgcacgtc
gaggatctgcacaccgacgcgatgggcaacgtgatcgggaccgtcgagggcgagtcggcg
tactcggtggtcgtcgccgcgcacatggacgagatcggcttcatggtcacgcacgtcgac
gagaacggctttctcgccgtcgacccgctcggcgggttcgatccccgagtcctgaaagcc
cagcgggcgaccgttcacacgcgcggcggggacctgccgggcgtcatcgggtcggcccca
ccccacacgctggacgaggccgaccgcgagaagacaccgaaggtcgaggacgtgcgcatc
gatctcggtctcgacgcggagacggtcgaggagcgcgtctcgccgggtgacctcgtgacg
ctggatcaagggacggaaatcgtcggcgaacacgtcacggggaaggcggtcgataaccgg
gtgagcgtactggcgctgatcgaggccgcccggcgactcgactcgccagcagtgacggtt
catttcgccgcgacggtccaagaggaggtcggactccggggagcgaacgcgctgggggtc
gacctcgatccggatctggcgatcgcgctggatacgaccgtcgcaaacgacgttccgggc
ttcgaggagcgcgagtacgtcacccggtgtggagagggcgtcgcgatcaagctgaaggac
tcgagcgtgatcaccagcccgaaggtccaccgacgcctcgcggcggtcgccgagacggag
ggcatcagccaccagttcgaggtcctgccggcgggtgggaccgacacggcgggctttcag
accgcggcgggggccaaacccgtcggcgcgctctcgattccgacccggtatctccacacc
gtcaccgagagcgctcatctcagggacgtcggggcgacgatcgaccttctgagcgccttc
ctcgacggcgagaccggcgagggtgactaccgtctctga

DBGET integrated database retrieval system