KEGG   Halalkalicoccus jeotgali: HacjB3_12795Help
Entry
HacjB3_12795      CDS       T01271                                 

Definition
L-threonine-O-3-phosphate decarboxylase
Orthology
K04720  
threonine-phosphate decarboxylase [EC:4.1.1.81]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Porphyrin and chlorophyll metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hje00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2368881..2369891
Genome map
AA seq 336 aa AA seqDB search
MKPDAIEGARRVPHGGCTDPGITDFSANINPRIPSGIAGVYEGALMQSKRYPADDYPEYR
TVAGEYVGCPPEDIVPTPGGLAGIRLALATSVSCDDSVLVPAPSFGEYAREVELQGGVVE
RVPHDEILRTDPSDHAMAIVCNPNNPTGTVYESGDLLDFLARCRHADTTLLVDEAFLGFT
DRPSMAGQRGAIVARSLTKLFGLPGLRAGFLVASGAPGERLKNARRTWNLSTPAVAVGAH
CMAQREFVTETRERVRTERERLVAALDGEYDVSPSEAPFLLLETGERAVDRVIERVALED
MTVRDARTFRGLDSHVRVAIRTPEENDRLLDALLDV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggacgctatcgagggggcgcggcgcgtaccacacgggggttgtaccgatccg
gggatcaccgacttcagcgcgaacatcaacccacggatcccatccggaatcgcgggcgtc
tacgaaggggcgttgatgcagtcgaaacgctacccggccgacgactaccccgaatatcgg
actgtcgccggcgagtacgtcggctgtccgcccgaggacatcgtccccacaccgggcggg
ctcgcggggatcagactggcgctcgcgacgagcgtctcctgtgatgactccgtgctcgtc
ccggccccgagtttcggcgagtacgcccgcgaggtcgaacttcagggaggtgtcgtcgag
cgtgtcccccacgacgagatcctccggaccgacccgagcgaccacgcgatggcgatcgtc
tgtaacccgaacaacccgaccgggacggtctacgagtccggcgatctgctggatttcctc
gcgcgctgtcggcacgccgacaccaccttgctcgtcgacgaggcgtttctcgggttcacc
gaccggccctcgatggcgggccagcgcggcgcgatcgtcgcccggtcgctcaccaaactc
ttcgggctcccgggcctccgggcggggtttctggtcgcctccggcgctccgggtgagcgc
ctcaagaacgcccggcggacctggaacctctcgacgccggcggtggcggtcggtgcccac
tgcatggcccagcgggagttcgtcaccgaaacccgagagcgcgtccgaaccgagcgcgaa
cggctggtcgcggccctcgacggcgagtacgacgtcagcccctcggaggcaccgttcctc
ctgctcgaaacgggcgagcgcgcggtcgaccgggtgatcgagcgcgtcgcactcgaggac
atgaccgtccgggacgcccgcacgtttcggggcctcgattcgcacgtcagggtcgcgatc
aggacccctgaggagaacgaccggctgctcgacgcgctgctggatgtttga

DBGET integrated database retrieval system