KEGG   Halalkalicoccus jeotgali: HacjB3_14295Help
Entry
HacjB3_14295      CDS       T01271                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HacjB3_14295
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HacjB3_14295
Enzymes [BR:hje01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HacjB3_14295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2629741..2630493
Genome map
AA seq 250 aa AA seqDB search
MNTSEPIAPTVESILAAACEREGGKERLSVEARSFPEAVAEAEKDGRTPVIAEVKPTSPT
TKGVREDDPVELAREMVAGGATALSVLTEPEHFGGSPETLRRVREAVDVPVLRKDFLLRG
EQLDVVEADLVLLIARFVDDLAGLVSAAKERGFQPLVEVHTAAELGEAIEAGADVVGINN
RDLAQLEVDLATFESVASEAPEDVLLVAESGIGSKKDVRRMREAGADALLIGTAIMDGDV
RENTREFTTT
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacactagcgagccgatcgcgccgaccgtcgagtccatcctcgcggcggcgtgcgaa
cgcgaagggggcaaagagcgcctctcggtcgaggcccgatcgttccccgaggcggtcgcg
gaggccgagaaggacggacgaacgccggtgatcgccgaggtcaaaccgaccagcccgacg
accaagggcgtccgcgaggacgatccagtagaactggcccgggagatggtcgctggcggg
gcaacggcgctgtcagtactcaccgaacccgagcatttcgggggatcgcccgagactcta
cggcgggttcgtgaggcggtggacgtcccggtgctgcgcaaggacttcctgctgcgcggg
gagcaactcgacgtcgtcgaggccgacctggtcctcctgatcgcccggttcgtcgacgac
ctcgcggggctcgtctcggcggccaaggagcgggggttccagccgctcgtcgaggtccac
accgcggcggagctcggggaagcgatcgaggccggcgccgacgtcgtcgggatcaacaac
cgggatctcgcccagctggaggtcgacctcgccaccttcgaatcggtcgcgagcgaggcg
cccgaggacgtgctgttggtcgccgaaagcgggatcggctcgaaaaaggacgtccgtcgg
atgcgcgaggcgggcgcggacgcgctgttgatcggcactgccatcatggacggcgacgta
cgcgagaacacgagggagttcaccacgacatga

DBGET integrated database retrieval system