KEGG   Halalkalicoccus jeotgali: HacjB3_14305Help
Entry
HacjB3_14305      CDS       T01271                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HacjB3_14305 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HacjB3_14305 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HacjB3_14305 (trpA)
Enzymes [BR:hje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HacjB3_14305 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2631722..2632552
Genome map
AA seq 276 aa AA seqDB search
MSGSRIDEALRGEPAFIPYLAAGDPDVESTKEYVRALVRGGADIVELGLPFSEPIAEGST
IQNAIVRSLDGGMTPDAYFDLVEDLDVEVPIVCMTYYNLIYRYGSEEGPESFVRRAAEAG
IDGFVVPDLPAEESDPLREACDSYGLDLVFIVAPTTRGDRLKRIMDQVSGYVYVQARLGT
TGARTDVSEQTDMSLGRLEEWDVPKAVGFGISEREHAERIVAGGADGIIVGSALVDIVAE
GDTDDGTVAERLERKARELKEGALAGAESRPQPERP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggagtcgcatcgacgaggccctgcggggggaaccggcgttcatcccgtatctc
gctgcgggcgacccggacgtcgaatcgaccaaagagtacgtccgcgcgctggtccggggc
ggggccgatatcgtcgaactggggcttcccttctcggaaccgatcgccgagggctcgaca
atccagaacgcgatcgtccggtcgctggacggcgggatgactcccgacgcctacttcgat
ctggtcgaggatctggacgtggaggtgccgatcgtctgcatgacctactacaacctgatc
tatcggtatggttcggaggaagggcccgagtcgttcgtgcgccgggccgcggaggccggg
atcgacggcttcgtcgtccccgacctgcccgccgaggaatcggacccgctccgggaggcc
tgtgattcctatgggttagacctggtcttcatcgtcgcgccgacgacgcgcggcgaccgc
ctgaaacggatcatggaccaggtctcgggctacgtctacgtccaagcgcgcctcgggacc
acgggtgcacggaccgacgtgagcgagcagaccgacatgagcctcggacggctagaagag
tgggacgttccgaaggccgtgggcttcgggatcagcgagcgtgaacacgcagaacgcatc
gtcgcgggcggggccgacgggatcatcgttgggagcgcgctcgtcgatatagtagccgag
ggcgatacggacgacggaacggtcgccgagcgccttgaacgaaaagcgagggaactgaag
gaaggcgcactcgcgggtgcggaaagccggccgcaaccggaacgtccataa

DBGET integrated database retrieval system