KEGG   Halalkalicoccus jeotgali: HacjB3_14550Help
Entry
HacjB3_14550      CDS       T01271                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase, type I
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:hje01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hje01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hje00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2682230..2683279)
Genome map
AA seq 349 aa AA seqDB search
MSNNFENEPVRVGLNGFGRIGRNVFRAAMTSSKVELVGINDIMDVEDMHYLAKYDTVQGR
LDGLELEGDSLVYEGTEVPTFSEKDPTQLPWDELDVDVAFEATGIFRTREDAAQHLEAGA
EKVIISAPPKGETPVKTIVYGVNHDEYDGDDVVSNASCTTNSVAPVAKVLDEEFGIESGL
LTTVHAYTGTQNLVDGPSGKTRRGRAAAENIIPTSTGAAQSTTEVLPNLEGKLDGMAMRV
PVPTGSITDLVVDLAADVGAEEVNEALREAADGDLAGVLGYTDDEIVSRDIVGLPFSSYV
DLDSTIAVEGGQVKVLTWYDNEYGFANRMLDLAQYVVAQDEETPAEATA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataacttcgaaaacgaaccggtgcgggtgggactgaacgggttcgggcggatc
gggcggaacgtcttccgggccgcgatgacctcctccaaggtggagctggtggggatcaac
gacatcatggacgtcgaggacatgcactacctcgcgaagtacgacaccgtccagggtcgc
ctcgacgggctcgaactggagggcgactcgctcgtctacgagggcaccgaggtcccgacg
ttcagcgagaaggacccgacccagctcccgtgggacgaactggacgtcgacgtcgccttc
gaggcgacgggcatcttccgaacccgggaggacgccgcccagcacctcgaggccggcgcc
gagaaggtcatcatcagcgcgccgccgaaaggcgagacgccggtcaaaacgatcgtttac
ggcgtcaaccacgacgaatacgacggcgacgatgtcgtctcgaacgcctcctgtaccacc
aacagcgtcgcgccggtggcgaaagtactcgacgaggagttcggcatcgagtcggggctg
ctcaccaccgtccacgcctacacgggcacccagaacctcgtcgacgggccctcgggcaag
acgcgccggggccgggccgccgccgagaacatcatcccaacctcgacgggcgcggcccag
tcgaccacggaggtcctgccgaacctcgaaggcaaactcgacgggatggccatgcgcgtg
cccgttccgacgggctcgatcaccgacctcgtcgtcgacctcgcggccgacgttggggcc
gaggaagtaaacgaggcgctccgtgaggccgcggacggcgatctggccggcgtgctcggc
tacaccgacgacgagatcgtctcgcgggacatcgtcgggctccccttttcgtcctacgtc
gacctcgattcgaccatcgcggttgagggcgggcaggtcaaggtgctgacgtggtacgac
aacgagtacggcttcgccaaccggatgctcgacctcgcacagtacgtcgtcgcgcaggac
gaggagacgcccgccgaagcgacggcgtag

DBGET integrated database retrieval system