KEGG   Halalkalicoccus jeotgali: HacjB3_15115Help
Entry
HacjB3_15115      CDS       T01271                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HacjB3_15115
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HacjB3_15115
   00052 Galactose metabolism
    HacjB3_15115
   00500 Starch and sucrose metabolism
    HacjB3_15115
   00520 Amino sugar and nucleotide sugar metabolism
    HacjB3_15115
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HacjB3_15115
   00524 Butirosin and neomycin biosynthesis
    HacjB3_15115
Enzymes [BR:hje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HacjB3_15115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2785835..2786812
Genome map
AA seq 325 aa AA seqDB search
MAHYAGVDLGATNIRAAVADGEAEILAVARRETPQGPTGIDVTEAVLRALRAACEEATVE
PHSIAAAGIGSFGPFDLAAGTIENPANLPDTVETIPLTGPVEKLIDSEKVYLHNDTIAGV
IGERFHSDRNPDDMVYLTISSGIGAGVCVDGNVLSGWDGNAGEVGHMTIDPEGLRTCGCG
HDGHWEAYCSGNNIPKYARLLYRDAQGMDTTLPIADPDFSAVDVFEYAAEDDFARYVVEQ
VGHWNAMGVANIVHAYAPLVVYVGGAVAINNPELTLDPIREKLEEMVFVNIPQIELTTLG
DDVVLHGAIASAMTGGTGDRARMRS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcacactacgccggcgtggatctcggggcgacgaacatccgggcggcggtcgccgac
ggcgaggccgaaatcctcgcggtcgcccgccgggagaccccacaggggccgaccgggatc
gacgtcaccgaggccgtcctgcgcgcgctccgggcggcctgcgaggaggcgaccgtcgaa
ccgcactcgatagcggccgccggaatcggcagtttcggcccgttcgacctcgcggctggc
acgatcgagaaccccgcgaacctccccgacaccgtcgagacgatcccgcttaccggtccc
gtcgagaaactcatcgactccgagaaagtctacctacacaacgataccatcgccggcgtc
atcggcgagcgctttcactccgatcggaaccccgacgacatggtctatctcaccatctcc
tcggggatcggcgccggggtctgtgtcgacggcaacgtcctctccggttgggacggcaac
gccggcgaggtcggccacatgaccatcgatcccgaggggctcagaacctgtggctgtggt
cacgacggccactgggaggcctactgttcgggcaacaacatcccgaagtacgcccgcctg
ctctatcgggatgcacagggcatggacaccacgcttccgatcgccgaccccgacttctcc
gcggtcgacgtcttcgagtacgccgccgaggacgacttcgcccggtacgtggtcgagcaa
gtcggccactggaacgcgatgggcgtcgcgaacatcgttcacgcgtacgcgccgctggtg
gtctacgtcgggggtgcggtcgcgatcaacaaccccgagctcaccctcgatcccatccgc
gagaagctcgaagagatggtgttcgtcaacatcccgcagatcgagctgacgacgctgggc
gacgacgtggtgcttcacggtgcgatcgcgagcgcgatgaccggtggaacgggcgaccgg
gcccgaatgcgaagttga

DBGET integrated database retrieval system