KEGG   Halalkalicoccus jeotgali: HacjB3_16061Help
Entry
HacjB3_16061      CDS       T01271                                 

Definition
Uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HacjB3_16061
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    HacjB3_16061
Enzymes [BR:hje01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     HacjB3_16061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:complement(135451..136425)
Genome map
AA seq 324 aa AA seqDB search
MSYNNETDTGRGGTDRRTMNYGKEQVAVYRTYANPLEGVRTIPESSFDGRDNILFGLEVR
VQFEGEEFLPSFSEADNTTVVATDSMKNFVLHQAGEYEGATAEGFLHFVGTEFLETYPHV
EAVTMSATEYPFDERPVPGDDGFDPSDLVFRVSDDESAFGEIYLEREGDELRFEEQTSGV
TEIELVKVKENSFTGYVQDEYTTLPEREDRALYISLDVFWTYSDPEDALGDEPQRYVPAE
QVRDIAQVVFHEVNSNSIQDLIYQIGLRVLERYPQLESVNFEANNRTWIEVRDDLDGDAK
VLREPPRPTGYQQFSMDRSDLEEQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagttataacaacgaaaccgacaccggacgtggagggaccgatcgacgaacgatgaac
tacgggaaagaacaggtcgcagtctaccgaacctacgcgaatccgctagaaggcgttcga
accattcccgaatcgtccttcgacggtcgtgacaacatcctcttcggtctggaggtgcgc
gtccagttcgaaggggaggagttcttaccgtcatttagtgaggcggacaacactaccgtg
gtggcgacggattcgatgaagaacttcgttcttcaccaagcaggggagtatgaaggagcg
acagcggagggttttcttcacttcgtcggaacggaattcctcgaaacgtacccgcacgtc
gaagcagtaacgatgtcagcgaccgagtatccgttcgatgaacgcccggtgccgggtgat
gacgggttcgatccgagcgatctcgtgttccgcgtctccgatgacgagtcagcgttcggt
gagatctaccttgagcgggaaggcgacgaactgcggttcgaagagcaaacaagcggtgtt
accgaaatcgaactcgtcaaagtaaaagagaactcgttcacggggtacgttcaggacgaa
tatacgacacttccagagcgggaagatcgtgcactctacatctcgctggatgtcttctgg
acctatagtgatcccgaagacgcattgggagacgaaccccagcgctacgttccggccgag
caggttcgtgacatcgctcaagtcgtgttccacgaggtgaattcgaactctattcaggac
ttgatctatcagatcggcctccgggttctggagcgctatccgcaactcgaatccgttaat
ttcgaagcgaacaaccgaacgtggatcgaggtgcgcgacgacctagatggggacgcgaaa
gttctcagagagccaccacgtccgaccggctatcagcagttctcgatggatcgcagcgat
ctagaggaacaatga

DBGET integrated database retrieval system