KEGG   Halalkalicoccus jeotgali: HacjB3_16721Help
Entry
HacjB3_16721      CDS       T01271                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HacjB3_16721
  Lipid metabolism
   00600 Sphingolipid metabolism
    HacjB3_16721
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HacjB3_16721
Enzymes [BR:hje01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HacjB3_16721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1:279736..283866
Genome map
AA seq 1376 aa AA seqDB search
MNSKETQTEDQMENNSGFRTSRRTFLELSGAAALVTAGGAASVTAAKPTTKIGSGPGRIH
DLSTYLEDPTRFEENREPTHAPTTIPYESVTQAIESDEPFTELEERFDGSPYFELLNGTW
NFQFFERPSDLPESLDGANDWDEITVPRPWQTEGYDERVYTNWQPTWVGYDPDLEWELYP
DEEGMVDVPGVGDDGPNPVGVYNRTIDVPADWEGRETFLHFEGVKQAYFVWIDGEYVGFQ
QGSMTPGEFHISEYVEAGASHDLTVQIYRWSDGEALECVDMHKYAGIYRSAYLFSTPPVH
IRDFAVRTGLDDEYEDATLRVDVELAEYSVPDETEYLVRATLCEPDSRSEVVTCEESVTV
EGGAVTTLETDVSDPAKWSAEDPTLYPLLVELLPAGRDTEDQSEPEPSEVLFEKVGFREY
EAERGPGGHITVNGEPVNVRGINRHETDPDTGRTVPLETMREDFELLKQFNLNSVRTSHY
PNDPTFYRLADEYGIYVQDEVNCETHWWEGVLAETTAYHDQSVERFRRMVLRDRNHASIF
SWSTGNEAGTGAEHLNMAALAIGGDDPTLPADTSETTRLSGEAIESFDANGIDALSPDRI
MYHQPNHGGWDVEYSDMLGPRYIDAETLATFGAGGDVSDSPRFGDRSSGDGSPGDGERSV
VMGEYNHAMGNSLGLIDEMWNDYIQPPVRRVRDRVGDADGVLLGSPMVVAGTDGGALELD
GQSDYIEVVPSDQPVSGSEFTIELTVSELIADGDAPLVVAGDQCTLAVTAAGDLEFTVGE
TSVTGELPAIETETQTLTAVYSARELALYVNGEQIGIAEHDRRDLDRTDETLLIGHDGRS
DRFLQATIESIAVYQSALSATDIGQESPTDETVLWYDFDDLLGDKSLQGGFIWDWVNQDL
NDETEDGEPFQFYDLDGPAGAFCLNGTTWSDRRPQPEMWQLKQCHQPVKMAPRDLAQGEV
YITNHHQFTDLQGFDITWTLSAAGQTVREDTLDLQTPPNTTEIVSIDGLVHAPNSEPGAE
YWVDISVSIPEDTSWSDEGHEIAFAQFPVPIETPAPKRRRTGGRPPVTTAETDTELVITG
KKFEYTLDKSLGTFSSMQYEGTELVERGPVLNFWRAPIMNELQDWGPHPAPSWYDLGLDD
IRHEVDDIEITEHKHSVDIEVDSLAFGATDDGAPAGYETTYCYHVAGDGEVQIDVQVDPT
DRLVADVGEWLPKIGLQLEFLEEFDQFEWYGRGPIETYPDRKTGVRVGHYAGSVEQQHVP
YLPPQDNGNKTDTRWASLSNGSVGVAAFGGSLLDVSLEQYGNLADADYQYQLEERGSVGF
NLDHAVTGVGGTPVPTADEYQVQPESTEFSITLCPFRATEGPMNVLGGNLPSTQDR
NT seq 4131 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgaaggagactcaaacagaagatcagatggagaacaactcagggtttcggacg
tctcggcggacgttcctcgaacttagcggcgcggctgcactcgtcacagcggggggcgcc
gcgagcgtcactgcagcaaaaccaaccaccaaaatcggatctggccccggacggatccac
gatctctctacgtatctggaagatcctactcgattcgaagaaaatcgcgagccgacccac
gcaccgacgacgatcccctatgaatcggttacgcaggcgatcgaatccgacgaaccgttt
accgaactcgaggaacgtttcgatggctcaccgtacttcgaactcctgaatgggacatgg
aacttccaatttttcgaacgtccttccgatcttccagagtcactcgatggggccaacgac
tgggacgagatcacggttccccgcccttggcagaccgaagggtacgacgaacgcgtctac
acgaattggcagccaacgtgggtgggatacgatcccgatctcgaatgggagctctatcca
gacgaagagggaatggttgacgttcccggcgtcggtgacgatggtcccaatccggttggc
gtgtacaatcgcacgatcgatgtcccagctgattgggagggccgtgagacgttccttcat
ttcgagggtgtcaagcaggcgtatttcgtctggatcgacggcgagtacgtcggcttccag
cagggatcgatgacacccggcgagttccatatctccgagtacgtcgaggctggcgccagt
cacgacctgacagtccagatctatcgttggagcgacggtgaggcgctggaatgtgttgac
atgcacaagtacgcgggtatctatcggagtgcgtatctgttttcgaccccgccggtccac
attcgtgacttcgctgtccggaccggtctcgacgacgagtacgaggatgcgacgttgcgg
gtcgatgtcgaactcgccgagtactcggtacccgatgagaccgagtatctagtgcgagcg
acgctatgcgagcctgacagtcgctcagaagtggtgacttgcgaggaatccgtcaccgtt
gaggggggtgccgttacgacgcttgaaaccgacgtcagtgaccccgcgaagtggtccgcc
gaggatccaaccctgtatccactgctcgtggaacttctcccagccggtcgggacactgag
gaccaatcggaacccgaaccgagcgaggtcctgttcgaaaaggttggtttccgcgaatat
gaggccgaacgtggaccgggtggccacatcacggtcaacggtgagcccgtcaacgtccga
ggtatcaatcggcacgaaaccgatccggataccggtcggacggtaccgctcgaaaccatg
cgcgaggacttcgagttgctcaagcagttcaacctcaactccgtgcggacctctcactac
ccgaacgatccaaccttctaccgactcgccgacgagtacgggatctacgtgcaagacgag
gtcaactgtgaaacccactggtgggagggcgtattagccgagaccaccgcataccacgat
caaagtgtcgagcggttccggcgaatggtgcttcgcgatcggaatcacgcgtcgatattc
tcgtggtcgacgggcaacgaggccggcaccggggccgaacatctcaacatggccgcactg
gcgatcggtggtgacgatccgacactacccgcggatacgagcgagacgacgcgcctgtcg
ggcgaagcaatcgaatcgttcgacgccaacggaatcgatgccctctcacccgaccggatc
atgtaccaccagcccaaccatggcggctgggacgttgagtacagtgacatgctcggtccg
cggtatatcgatgccgagacgctagcgacattcggagcgggtggtgacgtcagtgatagt
ccccggttcggcgatcggtcgagtggagatggctcgcccggtgacggcgagcggtcggtt
gtcatgggcgagtacaaccacgcgatgggcaatagtctcggactgatcgatgagatgtgg
aacgactatatccagccaccggtccgccgggtacgtgatcgggttggcgacgcagatggc
gtcctacttggatcaccgatggtcgttgcggggacggacggtggcgcactcgaattagat
ggccagtctgactatatcgaggtagtcccatccgatcagccggtgtccgggtccgaattt
accatcgagctgacggtaagcgaactcatcgctgacggtgatgcaccactggtcgtggcc
ggtgatcagtgtacactcgctgtgacggccgcaggagacctcgaattcaccgtcggagag
acatcagtgaccggagagctccctgcgatcgagacggagacgcaaacgctgacagccgtc
tattcggctagagaactcgcgctctacgtaaacggggagcagatcggtatcgctgaacac
gaccgccgtgatctcgacaggaccgacgagacactgctcatcggtcatgacggtcgtagc
gatcggttcctacaggcgacgatcgagtcgattgctgtctaccagtcagctctttcggct
accgacatcgggcaggagagcccaactgacgagaccgtcctctggtacgactttgatgac
ctgctgggagacaagagcctccaagggggcttcatctgggactgggtcaaccaggatctg
aatgacgagaccgaggacggcgaaccgttccagttctacgatctcgatggtccagcgggg
gctttctgtttgaacgggacgacctggtcggatcgacgtccccagcccgaaatgtggcaa
ctgaaacagtgccatcagccagtgaaaatggctccgcgagatctggcacaaggggaggtc
tacatcaccaatcaccaccagtttacggacttacagggattcgatatcacgtggacgctc
tcggcggccggacagacggtacgcgaagatacactcgatctccagacaccgccgaacacg
accgagatcgtctcgatcgacggtctcgtgcatgcaccgaattccgaacctggggcagag
tattgggtcgatatctccgtctcgattcctgaggacaccagttggagtgacgaaggtcat
gaaatcgccttcgcgcagttcccggttccaattgagactcctgctcccaagcgtcgtagg
acaggcggtcgaccgccggtcacgaccgcggaaacggacacggaactcgtaataacgggc
aaaaagttcgagtatacgctcgataagtcgctgggaacgttctcctcgatgcaatatgag
gggaccgaactcgtcgagcgcggtccagtcctcaatttctggcgggcaccgatcatgaac
gaactccaggattggggccctcatccggcaccgagctggtatgatctgggactcgacgac
attcgacacgaggtcgacgatatcgagatcacggaacacaaacacagtgtggatatcgag
gtcgatagtttagcattcggagcaaccgacgacggggcgccagccggctacgagacgacc
tactgctatcacgtcgccggagacggcgaggtgcagatcgacgttcaggtagatccgacc
gaccgccttgttgcagacgtcggcgagtggcttccgaaaatcggcctgcaactagaattc
ttagaggagttcgatcagttcgagtggtacggtcgcggacccattgagacgtatcctgat
cggaagaccggcgtgcgagtcggtcactacgcgggatcagtcgaacagcagcacgtcccg
tatctcccaccgcaggacaacggaaacaagaccgatacgcgctgggcttcactcagtaac
ggttcggttggagtggctgcattcggcggttcgctattagatgttagtctcgaacagtat
ggaaacctcgcggacgccgactatcagtatcaactcgaagagcgtggttcggtcgggttc
aatctcgaccacgcggtaaccggtgtcggtggaacacccgttccaacggccgatgagtac
caagttcaacccgaatcgaccgaattctctatcactctctgtccgtttcgagctaccgag
ggcccgatgaacgtcttgggagggaacctcccgtctacgcaagataggtga

DBGET integrated database retrieval system