KEGG   Halorubrum lacusprofundi: Hlac_0043Help
Entry
Hlac_0043         CDS       T00856                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hla01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hla00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hla00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hla00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hla00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:hla00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(45462..46442)
Genome map
AA seq 326 aa AA seqDB search
MYYVGVDLGATNVRAVVGDETATVLGSDSRGTPSGPNGIAVTEAVLGVVRGACEDAGIDP
TAVVAAGIGSIGPLDLAAGIVQGPANLPDTVERIPLIGPVSQLLDTDEVHLHNDTIAGVI
GERFHSERNPDDMVYLTISSGIGAGVAVDGNVLSGWDGNAGEVGHMTVDPHGFMTCGCGL
DGHWEGYCSGNNIPKYARELHEEDPIETSLPIEDPDFSAVDVFEAAGEDTFADHVIAQVA
HWNAMGVANVIHAYAPLVVSVGGAVALNNPELVLDPIREKLADMVFINVPEVRLTELGDD
VVVKGALASALTGGTGDRSRVDPPPR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtactacgtgggcgtcgacctcggagcgacaaacgtccgggcggtcgtcggcgacgaa
accgcaaccgtcctcggatccgactcgcgagggaccccgagcgggccaaacgggatcgcg
gtcaccgaggccgttctcggcgtggtccgcggcgcgtgcgaggacgccggaatcgacccg
accgcggtagtcgcggctgggatcggctcgatcggtcccctcgatctggctgccgggatc
gtacagggaccggcgaatctcccggacaccgtcgaacgaattcccctcatcggaccggtt
tcacagctgttagacaccgacgaggtccatctccacaacgacaccatcgcgggcgtcatc
ggcgagcggttccattccgagcgcaaccccgacgacatggtgtatctcaccatctcctcc
ggtatcggtgccggcgtcgccgtcgatggcaacgtgctctcggggtgggacggcaacgcc
ggcgaggtcggccacatgacggtcgacccgcacggcttcatgacctgtggatgcgggctc
gacggccactgggaggggtactgctcgggcaacaacatcccgaagtacgcccgcgagctc
cacgaggaggacccgatcgagacctccctgccgatcgaggaccccgacttctccgcggtc
gacgtgttcgaggcggccggcgaggacaccttcgccgaccacgtgatcgctcaagtcgcc
cactggaacgcgatgggcgtcgccaacgtcatccacgcgtacgccccactagtcgtgagc
gtcggcggcgcggtcgcgctcaacaaccccgagttggtgctcgacccgatccgcgagaag
ctcgcggacatggtgttcatcaacgtccccgaggttcgcctcaccgaacttggcgacgac
gtggtggtgaagggcgcactcgcgagcgcgctcacgggcggcacgggcgaccgatcgcgg
gtcgacccgccaccgaggtga

DBGET integrated database retrieval system