KEGG   Halorubrum lacusprofundi: Hlac_0141Help
Entry
Hlac_0141         CDS       T00856                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00010  Glycolysis / Gluconeogenesis
hla00020  Citrate cycle (TCA cycle)
hla00620  Pyruvate metabolism
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01120  Microbial metabolism in diverse environments
hla01130  Biosynthesis of antibiotics
hla01200  Carbon metabolism
Module
hla_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_0141
   00020 Citrate cycle (TCA cycle)
    Hlac_0141
   00620 Pyruvate metabolism
    Hlac_0141
Enzymes [BR:hla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Hlac_0141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACM55747
JGI: Hlac0141
UniProt: B9LRC4
Position
1:149326..150945
Genome map
AA seq 539 aa AA seqDB search
MPVKEFKLPDVGEGVAEGELVTWLVAPGDRVEEDQPVAEVETDKALVEVPSRYDGTVEEL
FVEEGDIVPVGDVIISFRVGEDGEDVEAGGDDSAETGADATEPEPETDIGAETDAESDAE
TEPDTPPGRTFAPPSARRLARELGVDIAVVDGSGPGGRIGEADVRAHAEGGGDHAGADAG
DSGSDKAPAPTPTDVGSSDRKSAVHKRGDDGSAESSADAPSAAGAPESAGRETTLATPAT
RKVARELGVDIDDVPTDETRDGEAFVTGEIVRAYAEALESGASPAADAVDTSAPEPKSAD
ASLSAPGSADETIPYRGVRRTIGKQMERSKYTAPHVSHHDTAEVDGLVAAREELKRRAEE
QGVKLTYMPFVMKAIVAGLKEYPSLNSELREDDEEIVLKGDYNLGIAVATDAGLMVPVVE
NVDEKGLFELAEEVRDLASRARERKLTPAEMKGGTFSITNFGAIGGEYATPIINYPETAI
LGLGAIEERPVVRDGEVVAAPTLPLSLSIDHRVIDGAVAAEFANTVMEHLEHPLLLLTQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcaaagagttcaaactgcccgacgtgggcgaaggagtcgccgagggcgagctg
gtcacttggctggtcgcgcccggcgaccgcgtcgaggaggatcagccggtcgcggaggtc
gagaccgacaaggcgctcgtcgaggtcccctcgcggtacgacgggaccgtcgaggagctg
ttcgtcgaggagggagatatcgtccccgtcggcgacgtgatcatctcgttccgcgtcgga
gaggacggtgaagacgtcgaggcgggaggagacgactccgcagagacgggagccgacgcc
acggagccggagccggagacggacatcggcgccgagaccgacgcggaatccgacgccgag
acggagcccgacaccccgcccggccggaccttcgcgccgccgtcggcccgtcgactcgcc
cgcgaactgggcgtcgacatcgccgtcgtcgacgggagcggtcccggcggtcggatcggc
gaggccgacgtgcgggcgcacgcggagggcggtggcgaccacgctggcgccgacgcgggc
gattctggctccgacaaggcaccggccccgaccccgaccgacgtgggatccagtgaccgg
aaatccgccgtacacaagcgcggtgacgacggatccgccgaatcctctgcggacgccccg
tccgctgccggggctcccgagtcggccggccgcgagacgacgctcgcgacgcccgcgacc
cggaaggtcgcccgcgaactgggcgtcgacatcgacgacgtgccgaccgacgagacccgg
gacggcgaggcgttcgtcaccggcgagatcgttcgggcctacgcggaggcgctggagtcg
ggggcgtcgcccgcggcggacgcggtcgatacgtcggcgcccgaaccgaaatccgccgat
gcctcgctgagcgcccctggctcggccgacgagaccatcccctatcgcggggtgcggcgt
accatcggaaagcagatggagcggtcgaagtacaccgctccgcacgtcagccaccacgat
accgccgaggtcgacgggctggtggcggcgcgggaagaactgaaacggcgcgcggaggag
cagggcgtgaagctcacctacatgccgttcgtgatgaaggcgatcgtcgcggggctgaag
gagtacccgtccctcaacagtgagcttcgcgaggacgacgaggaaatcgtgttgaagggc
gactacaacctcgggatcgccgtcgcgaccgacgccgggctgatggtgccggtcgtcgag
aacgtcgacgagaaggggctcttcgagctggcggaggaggtcagagatctcgcttcgcgc
gcccgcgagcgcaagctcacgccggcggagatgaagggcggcacgttctcgatcaccaac
ttcggcgccatcggcggggagtacgccacgccgatcatcaactatcccgagaccgcgatc
ctcgggctgggcgccatcgaggagcgcccggtcgtgcgcgacggtgaggtcgtcgcggcg
ccgacgcttccgctttcgctgtcgatcgaccatcgcgtgatcgacggcgcggtcgcggcc
gagttcgcgaacaccgtgatggaacaccttgaacatccgctgctactgttgactcaataa

DBGET integrated database retrieval system