KEGG   Halorubrum lacusprofundi: Hlac_0683Help
Entry
Hlac_0683         CDS       T00856                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hlac_0683
   01230 Biosynthesis of amino acids
    Hlac_0683
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_0683
   00051 Fructose and mannose metabolism
    Hlac_0683
   00562 Inositol phosphate metabolism
    Hlac_0683
Enzymes [BR:hla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hlac_0683
Exosome [BR:hla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hlac_0683
  Exosomal proteins of bladder cancer cells
   Hlac_0683
  Exosomal proteins of melanoma cells
   Hlac_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(701601..702245)
Genome map
AA seq 214 aa AA seqDB search
MFILVNLKAYPCDPIEVATAARDVAEASGARIAVSPQAADIARVADTGVETWAQHVSPNA
HGSHTGSTLAEAVADNGAEGTLINHSENRLKLADIDGSVHAAERTELETIVCANNPAQVG
AAAALGPDAVAVEPPELIGGDVSVSTADPGIVEDAVAAAEAVDPAVDVFCGAGVSTGDDV
VAAGDLGAAGVLLASGVAKADDPKAVLEDLVSGI
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcattctggtgaacctcaaggcgtacccgtgcgacccgatcgaagtcgcgaccgct
gcccgcgacgtcgccgaagcgtccggcgcccggatcgcggtctcgccgcaggccgccgac
atcgcccgcgttgccgacaccggcgtcgagacgtgggcccagcacgtctcgccgaacgcc
cacggctctcacaccgggtcgacgctcgccgaggccgtcgccgacaacggcgcggagggg
acccttattaaccactccgagaatcgcctgaagctcgccgacatcgacggctccgttcac
gcggccgagcgcaccgaactggagacgatcgtctgcgcgaacaaccccgcgcaagtcggc
gcagccgccgcactcggtcccgacgcggtcgctgtcgagccgccggaactcatcggcggc
gacgtctccgtctcgactgccgacccggggatcgtcgaggacgcggtcgcggccgccgag
gccgtcgatcccgccgtcgacgtgttctgcggtgccggcgtctcgaccggcgacgacgtg
gtcgccgccggcgacctcggcgccgccggcgtcctgttggcctccggcgtcgcgaaggcc
gacgacccgaaggccgtgctcgaagacctcgtcagcgggatctga

DBGET integrated database retrieval system