KEGG   Halorubrum lacusprofundi: Hlac_0683Help
Entry
Hlac_0683         CDS       T00856                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:hla01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hla01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hla00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hla00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hla00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(701601..702245)
Genome map
AA seq 214 aa AA seqDB search
MFILVNLKAYPCDPIEVATAARDVAEASGARIAVSPQAADIARVADTGVETWAQHVSPNA
HGSHTGSTLAEAVADNGAEGTLINHSENRLKLADIDGSVHAAERTELETIVCANNPAQVG
AAAALGPDAVAVEPPELIGGDVSVSTADPGIVEDAVAAAEAVDPAVDVFCGAGVSTGDDV
VAAGDLGAAGVLLASGVAKADDPKAVLEDLVSGI
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgttcattctggtgaacctcaaggcgtacccgtgcgacccgatcgaagtcgcgaccgct
gcccgcgacgtcgccgaagcgtccggcgcccggatcgcggtctcgccgcaggccgccgac
atcgcccgcgttgccgacaccggcgtcgagacgtgggcccagcacgtctcgccgaacgcc
cacggctctcacaccgggtcgacgctcgccgaggccgtcgccgacaacggcgcggagggg
acccttattaaccactccgagaatcgcctgaagctcgccgacatcgacggctccgttcac
gcggccgagcgcaccgaactggagacgatcgtctgcgcgaacaaccccgcgcaagtcggc
gcagccgccgcactcggtcccgacgcggtcgctgtcgagccgccggaactcatcggcggc
gacgtctccgtctcgactgccgacccggggatcgtcgaggacgcggtcgcggccgccgag
gccgtcgatcccgccgtcgacgtgttctgcggtgccggcgtctcgaccggcgacgacgtg
gtcgccgccggcgacctcggcgccgccggcgtcctgttggcctccggcgtcgcgaaggcc
gacgacccgaaggccgtgctcgaagacctcgtcagcgggatctga

DBGET integrated database retrieval system