KEGG   Halorubrum lacusprofundi: Hlac_0724Help
Entry
Hlac_0724         CDS       T00856                                 

Definition
(GenBank) peptidase M42 family protein
Organism
hla  Halorubrum lacusprofundi
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(739979..741031)
Genome map
AA seq 350 aa AA seqDB search
MSFEFDYDLLRELTEARGVPGYEDEVREIVRREFADRADRVRTDAMGNVVATLEGDSDYS
VAVAAHMDEIGFMVRHVTDEGFVQVDPLGGFDARVLRAQRVTVHGEEDLTGVIGSVPPHT
LTDEQKEKDDEVSDVFIDVGRDAEAVEELVGVGDLVTLDQTTTRMGDRITGKALDDRICL
FATLEAAKRIEDPDVTIHFAATVQEEVGIRGATALGVDIDPDLAIALDVTVANDVPQIGE
PADAVTELGEGTAIKLKDSSVITSPKVHKRLTAVAEAEAIDHQHEVLPAGGTDTAGFQNT
AGAKPVGAISIPTRYLHTVTETADGDDVAATIDLLTAFLESESGEHDYTL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgagtttgattacgatctgctccgtgagttgactgaggcccgaggcgtcccg
ggatacgaagacgaagtccgcgagatcgtccgccgcgagttcgccgatcgcgccgaccgc
gttcgcaccgacgcgatgggaaacgtcgtcgccacgctcgagggtgactctgattactcg
gtcgccgtcgcggcccacatggatgaaatcggcttcatggtccgacacgtcaccgacgag
gggttcgtccaggtggatccgctcggtgggttcgacgcccgggtgctgcgcgcacagcgc
gtcaccgtccacggcgaggaggatctcaccggcgtcatcggctccgtcccgccgcacacg
ctcacggacgagcagaaggagaaggatgacgaggtctcggacgtgttcatcgacgtcggg
cgcgacgccgaggcggtcgaagaactcgtcggcgtcggcgatctggtcaccctcgatcag
acgacgacccgcatgggcgatcggatcacggggaaggcgctcgacgaccggatctgcctg
ttcgcgacgcttgaggccgcaaagcgaatcgaggatcccgacgtgacgatccacttcgcg
gcgacggttcaagaggaggtcgggatccgcggcgcgaccgcactcggcgtcgacatcgac
cccgacctcgcgatcgccttggacgtgaccgtcgcgaacgacgtaccccagatcggcgaa
ccggccgacgccgtgacggagctcggcgaggggaccgcgatcaaactgaaagactcgtcg
gtgatcaccagcccgaaggtccacaagcggctcactgcggtcgccgaagcggaggcgatc
gatcaccaacacgaggtgttgcccgcgggcggcaccgacaccgccgggtttcagaatact
gccggtgcaaagcctgtcggcgccatctcgatcccgacgcggtacctccacaccgtcacc
gaaaccgccgacggcgacgacgtggccgcgacgatcgacctgctgacggcctttttggag
tccgagtccggagaacacgactacacgctgtag

DBGET integrated database retrieval system