KEGG   Halorubrum lacusprofundi: Hlac_0934Help
Entry
Hlac_0934         CDS       T00856                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00220  Arginine biosynthesis
hla00330  Arginine and proline metabolism
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01130  Biosynthesis of antibiotics
hla01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Hlac_0934
   00330 Arginine and proline metabolism
    Hlac_0934
Enzymes [BR:hla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Hlac_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACM56532
JGI: Hlac0934
UniProt: B9LME4
Position
1:complement(934055..934960)
Genome map
AA seq 301 aa AA seqDB search
MTTVRIIGAPTDYGANRRGVDMGPSAIRYAGLADQLASAGVETVDAGDLAVPRAEERDPD
AEAPHEGDAKFLRETADVCRRLADEVSGTLAEGSVPLALGGDHSIAIGSLVGSARDAEIG
AVWFDAHADLNTPATTPSGNVHGMPLAAALGLGEFEGSDWATAPGLNPENVALVGLRSVD
DAEIDVIRDHGFAAYTMSDIDDRGITDVTEEAMAEASAGVDGVHVSLDLDWLDPKEAPGV
GTPVRGGVTYREAHRAMESVAETDCVRSMELVEVNPTLDQHNETAELATELAASAFGKRV
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgtcaggatcattggcgcaccgaccgactacggggcgaaccgacgcggtgtg
gacatggggccgtcagcgatccgctacgccgggctggccgaccagctcgcgagcgccggc
gtcgagaccgtcgacgcgggcgacctcgcggtcccccgcgcggaggagcgtgacccggac
gcggaggccccgcacgagggggacgcgaagttcctccgcgaaaccgccgacgtctgccgc
cggctcgcggacgaggtgagcgggacgctcgccgaggggtctgtgccgctcgcactcggc
ggagaccactcgatcgccatcggttcgctcgtcggctccgcgcgcgacgcggagatcggc
gcggtgtggttcgacgctcacgccgacctcaacacgcccgcgacgacgccctccgggaac
gtccacgggatgccgctcgcggccgcgctcggcctcggcgagttcgaggggtcggactgg
gcgaccgcgcccgggctcaatccggaaaacgtcgcactcgtcgggctccgctccgtcgac
gacgcggagatcgacgtgatccgcgaccacgggttcgcggcgtacacgatgtcagacatc
gatgaccgcgggatcacggacgtgactgaggaagcgatggccgaagcgtcggccggcgtc
gacggcgtccacgtcagtctcgatttagactggctcgaccccaaggaggcgcccggcgtc
ggcacccccgtccgcgggggcgtcacctaccgggaggcgcacagggcgatggagtcagtc
gccgagaccgattgtgtccggtcgatggaactcgtcgaggtgaatccgacgctggaccag
cacaatgagaccgcggagctcgcgacggaactggccgcgagcgcgttcggaaagcgggtg
ctgtga

DBGET integrated database retrieval system