KEGG   Halorubrum lacusprofundi: Hlac_0990Help
Entry
Hlac_0990         CDS       T00856                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00010  Glycolysis / Gluconeogenesis
hla00620  Pyruvate metabolism
hla00640  Propanoate metabolism
hla00680  Methane metabolism
hla00720  Carbon fixation pathways in prokaryotes
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01120  Microbial metabolism in diverse environments
hla01130  Biosynthesis of antibiotics
hla01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_0990
   00620 Pyruvate metabolism
    Hlac_0990
   00640 Propanoate metabolism
    Hlac_0990
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hlac_0990
   00680 Methane metabolism
    Hlac_0990
Enzymes [BR:hla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hlac_0990
Lipid biosynthesis proteins [BR:hla01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hlac_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACM56587
JGI: Hlac0990
UniProt: B9LMJ9
Position
1:complement(980644..982656)
Genome map
AA seq 670 aa AA seqDB search
MDEYEGIDEIVHEPSEAFAESTNVAAFMREYGIDDYEDLIARTTSGIDGEPASGVDWFWD
EIVDYLDIDFYTEYDAVRDDSGGPQFTDWYPGGEINVAHNVVDRHAAVDSPNRNRVALIW
EGEPGDIREVTFHELARQTNRVANYLESVGIETGDTVGLYMPMVPEVVSILYGCLKVGAI
AVPIFSGFGTEATATRIADAEPSVLFTGDGFYRRGSEVRLKATADEAIEAAGHVDDVVVY
DRLGATPEGDAADPVPWNPDRDVTWTEAIESRSVDYETKRLPSDQESMLLYSSGTTGEPK
GIVHTHAGVLTQCAKEIHFGFDQKPADRFFWVSDIGWMMGPWTLIGNHASGGTVVMYEGA
PDHPEPDRFWEMIDRHGITQFGISPTAIRALRKHGDEWVEDHDLSSLRILGSTGEPWDPE
SWRWFYDAVGGGDCPIINISGGTEICGCFLMPMPNQPLKPCTLGGPGLGMDIDIVDESGE
SIKESGERGYLVARDSCPSMTKSLWSGDERYLKEYWSTWEDLWDHGDFAQKDADGFWFLH
GRADDALNVAGRKVGPAEIEGVLIDHDAVNQAAAVGVPDDTTGTAVVAYVVLEPHIEPSD
DLREELRTLVGEEHGKPFRPRELLFVDAFPKTQSGKIIRRAIASIYKGEDPGDLSSMENP
KALDGLRDPN
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtacgagggaatagacgagatcgtacacgagccgagcgaggcgttcgccgag
tcgacgaacgtcgctgcgttcatgcgcgagtacggcatcgacgactacgaggatctcatc
gcccggaccacctcggggatcgacggcgagccggcctccggcgtcgactggttctgggac
gagatcgtcgactacctcgacatcgacttctacaccgagtacgacgcagtgcgcgacgac
agcggagggccgcagttcaccgactggtaccccggcggcgagatcaacgtcgcgcacaac
gtcgtcgaccgacacgctgccgtcgactcgccgaaccgcaaccgagtcgcgctgatctgg
gagggcgagcccggcgatatcagggaagtcacgttccacgaactggcccgacagaccaac
cgcgtcgccaactacttggagtcggtcgggatcgagaccggagacacggtcgggttgtat
atgccgatggtgcccgaggtcgtctcgatcctctacggttgtttaaaggtgggcgcgatc
gcagtgccgattttctccggcttcggcacggaggcgacggcgactcggatcgcagacgcc
gagccgtcggtcctgttcaccggggacgggttctaccgtcgcgggagcgaggtgcgactg
aaagcgaccgccgacgaggcgatagaggcagccggccacgtcgatgacgtcgtcgtctac
gaccgcttgggcgcgacgccggagggcgacgctgcggacccggttccgtggaaccctgat
cgcgacgtgacgtggaccgaggcgatcgagtcgcggtcggtcgactacgagacgaagcgg
ctcccgagcgatcaggagtccatgctgttgtactcctccgggaccaccggcgagccgaag
gggatcgtccacacccacgcgggcgtcctcacgcagtgcgccaaggagatccacttcggc
ttcgaccagaagccggccgaccggttcttctgggtctccgacatcggctggatgatgggg
ccgtggacgctgatcgggaaccacgcgtccggcgggacggtggtgatgtacgagggtgca
ccagaccacccggagccggaccgcttctgggagatgatcgaccgacacggaattacgcag
ttcggcatctcgccgaccgcgatccgggcgctccgcaagcacggagacgaatgggtcgag
gaccacgatctctcctcactccgaatcttgggctcgaccggcgagccgtgggatcccgaa
tcgtggcgctggttctacgacgcggtcggcggcggcgactgcccgatcatcaacatctct
ggcggcacggagatctgcggctgcttcctcatgccaatgccgaaccagccgctgaaaccc
tgcacgctgggcggtccggggctcgggatggacatcgatatcgtcgacgagagtggcgag
tcgatcaaagagtcgggcgagcgcggctacctcgtcgcgcgcgactcctgtccctcgatg
acgaagtcgctgtggtcgggcgacgagcgctatttgaaggagtactggtcgacgtgggag
gatctgtgggaccacggcgacttcgcacagaaggacgcagacggcttctggttcctccac
ggacgcgccgacgacgccttgaacgtcgccggccgaaaggtcggcccggccgagatcgaa
ggcgtactcatcgaccacgacgccgtcaaccaggcggccgcagtcggcgtccccgacgac
accaccgggaccgcagtggtcgcgtacgttgtgctcgaaccccacattgagccgagcgac
gacctccgagaggagctgcggacgctcgtcggcgaggaacacgggaagccgttccgaccg
cgcgagctgctgttcgtcgacgccttcccgaagacgcagtccgggaagatcatccgacgc
gcgatcgcgtcgatttataagggcgaggaccccggagatctctcgtcgatggagaacccg
aaggcgctcgacgggctccgcgacccgaactga

DBGET integrated database retrieval system