KEGG   Halorubrum lacusprofundi: Hlac_0990Help
Entry
Hlac_0990         CDS       T00856                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hlac_0990
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_0990
   00620 Pyruvate metabolism
    Hlac_0990
   00640 Propanoate metabolism
    Hlac_0990
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hlac_0990
   00680 Methane metabolism
    Hlac_0990
Enzymes [BR:hla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hlac_0990
Lipid biosynthesis proteins [BR:hla01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hlac_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(980644..982656)
Genome map
AA seq 670 aa AA seqDB search
MDEYEGIDEIVHEPSEAFAESTNVAAFMREYGIDDYEDLIARTTSGIDGEPASGVDWFWD
EIVDYLDIDFYTEYDAVRDDSGGPQFTDWYPGGEINVAHNVVDRHAAVDSPNRNRVALIW
EGEPGDIREVTFHELARQTNRVANYLESVGIETGDTVGLYMPMVPEVVSILYGCLKVGAI
AVPIFSGFGTEATATRIADAEPSVLFTGDGFYRRGSEVRLKATADEAIEAAGHVDDVVVY
DRLGATPEGDAADPVPWNPDRDVTWTEAIESRSVDYETKRLPSDQESMLLYSSGTTGEPK
GIVHTHAGVLTQCAKEIHFGFDQKPADRFFWVSDIGWMMGPWTLIGNHASGGTVVMYEGA
PDHPEPDRFWEMIDRHGITQFGISPTAIRALRKHGDEWVEDHDLSSLRILGSTGEPWDPE
SWRWFYDAVGGGDCPIINISGGTEICGCFLMPMPNQPLKPCTLGGPGLGMDIDIVDESGE
SIKESGERGYLVARDSCPSMTKSLWSGDERYLKEYWSTWEDLWDHGDFAQKDADGFWFLH
GRADDALNVAGRKVGPAEIEGVLIDHDAVNQAAAVGVPDDTTGTAVVAYVVLEPHIEPSD
DLREELRTLVGEEHGKPFRPRELLFVDAFPKTQSGKIIRRAIASIYKGEDPGDLSSMENP
KALDGLRDPN
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtacgagggaatagacgagatcgtacacgagccgagcgaggcgttcgccgag
tcgacgaacgtcgctgcgttcatgcgcgagtacggcatcgacgactacgaggatctcatc
gcccggaccacctcggggatcgacggcgagccggcctccggcgtcgactggttctgggac
gagatcgtcgactacctcgacatcgacttctacaccgagtacgacgcagtgcgcgacgac
agcggagggccgcagttcaccgactggtaccccggcggcgagatcaacgtcgcgcacaac
gtcgtcgaccgacacgctgccgtcgactcgccgaaccgcaaccgagtcgcgctgatctgg
gagggcgagcccggcgatatcagggaagtcacgttccacgaactggcccgacagaccaac
cgcgtcgccaactacttggagtcggtcgggatcgagaccggagacacggtcgggttgtat
atgccgatggtgcccgaggtcgtctcgatcctctacggttgtttaaaggtgggcgcgatc
gcagtgccgattttctccggcttcggcacggaggcgacggcgactcggatcgcagacgcc
gagccgtcggtcctgttcaccggggacgggttctaccgtcgcgggagcgaggtgcgactg
aaagcgaccgccgacgaggcgatagaggcagccggccacgtcgatgacgtcgtcgtctac
gaccgcttgggcgcgacgccggagggcgacgctgcggacccggttccgtggaaccctgat
cgcgacgtgacgtggaccgaggcgatcgagtcgcggtcggtcgactacgagacgaagcgg
ctcccgagcgatcaggagtccatgctgttgtactcctccgggaccaccggcgagccgaag
gggatcgtccacacccacgcgggcgtcctcacgcagtgcgccaaggagatccacttcggc
ttcgaccagaagccggccgaccggttcttctgggtctccgacatcggctggatgatgggg
ccgtggacgctgatcgggaaccacgcgtccggcgggacggtggtgatgtacgagggtgca
ccagaccacccggagccggaccgcttctgggagatgatcgaccgacacggaattacgcag
ttcggcatctcgccgaccgcgatccgggcgctccgcaagcacggagacgaatgggtcgag
gaccacgatctctcctcactccgaatcttgggctcgaccggcgagccgtgggatcccgaa
tcgtggcgctggttctacgacgcggtcggcggcggcgactgcccgatcatcaacatctct
ggcggcacggagatctgcggctgcttcctcatgccaatgccgaaccagccgctgaaaccc
tgcacgctgggcggtccggggctcgggatggacatcgatatcgtcgacgagagtggcgag
tcgatcaaagagtcgggcgagcgcggctacctcgtcgcgcgcgactcctgtccctcgatg
acgaagtcgctgtggtcgggcgacgagcgctatttgaaggagtactggtcgacgtgggag
gatctgtgggaccacggcgacttcgcacagaaggacgcagacggcttctggttcctccac
ggacgcgccgacgacgccttgaacgtcgccggccgaaaggtcggcccggccgagatcgaa
ggcgtactcatcgaccacgacgccgtcaaccaggcggccgcagtcggcgtccccgacgac
accaccgggaccgcagtggtcgcgtacgttgtgctcgaaccccacattgagccgagcgac
gacctccgagaggagctgcggacgctcgtcggcgaggaacacgggaagccgttccgaccg
cgcgagctgctgttcgtcgacgccttcccgaagacgcagtccgggaagatcatccgacgc
gcgatcgcgtcgatttataagggcgaggaccccggagatctctcgtcgatggagaacccg
aaggcgctcgacgggctccgcgacccgaactga

DBGET integrated database retrieval system