KEGG   Halorubrum lacusprofundi: Hlac_1050Help
Entry
Hlac_1050         CDS       T00856                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00030  Pentose phosphate pathway
hla01100  Metabolic pathways
hla01120  Microbial metabolism in diverse environments
hla01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hlac_1050
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Hlac_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACM56647
JGI: Hlac1050
UniProt: B9LMQ9
Position
1:complement(1043545..1045212)
Genome map
AA seq 555 aa AA seqDB search
MLHSTGPLLSIDVGERTTVETDITEVQERYIGGRGVATRLAHERVPFDADPLGPENRAVF
TTGPMQASQMSFTGRTNCTALSPLTDGLLSSNAGGFVSRHLAATGYGAIELAGASDDLVI
VHVRDDGVEFEAVPDLAGATVSETTGYLEDERDISSDRTAVIGPAGENEVRFASIMTTEE
RAFGRGGLGAVLGAKNVKAVTFGGDSAPGLEISATANEIHREAATEDHIMKEQGTVAVMD
LANEMDGLPSYYFSERSFAGVEGINGAAVAEKKYKKGTCSACAFACKLPTRDEARGVETE
GPEFEVAMAFGSNSGVDDIVDVMESNRLCDEYGLDAISAGNTIAAYLAAEDEFGNRELIW
DLVDKIAQRDGVGDTLAEGIGRIHEDLGVGNWSVKNMDFAAHEGRLLHGQALSYAVANRG
ADHMYATFYSVEYPLVEEAEAMEPAGFEGKADRLVERENLMALNDSGVVCKFSRDFMTPE
RYELLFDADFEELLAAGARTVTLERHFNNRRGIDGDDDRLPYEDELPGLDDAIDSYYELR
GWNDDGTVPESALPA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgctacacagtaccggaccgctgctgtcgatcgacgtcggggagcggacgacggtagag
accgatatcacggaggttcaggagcgatacatcggcggacggggcgtggcgacgcggctc
gcgcacgagcgagtcccgttcgatgcggatccgctcggccccgagaaccgcgccgtgttc
accaccggaccgatgcaggcgtcccagatgagttttacagggcggacgaactgcaccgcg
ctctcgccgctgacggacgggctcctgtcatcgaacgccggcggcttcgtgtcgcgccac
ctcgcggcgacggggtacggagcgatcgagcttgcgggtgcaagcgacgacttggtcatc
gtccacgtgcgcgacgacggtgtcgagttcgaagccgtaccggacctcgcgggagcgacc
gtctcggagacgaccggctatttggaggacgaacgcgacatctccagcgaccggacagcg
gtgatcgggccggcgggcgagaacgaagtccgattcgcgtcgatcatgacgaccgaggag
cgcgcgttcggtcgcggcgggctgggcgccgtcctcggagcgaagaacgtcaaggccgtc
acgttcggcggtgactcggcacccgggctcgagatttcggcgaccgccaacgagatccac
cgcgaggccgccaccgaggaccacatcatgaaagagcaggggacggtggcggtgatggac
ctcgcaaacgagatggacgggttgccgtcgtactacttctccgagcgctccttcgcgggc
gtcgaggggatcaacggcgccgccgtcgcggagaagaagtacaagaagggaacctgctcg
gcgtgtgcgttcgcctgcaagctcccgacccgggacgaggcgcgcggcgtcgagaccgag
ggccccgagttcgaggtggcgatggcgttcggctcgaattcgggggtcgacgacatcgtc
gacgtgatggagtcgaaccgcctgtgcgacgagtacgggctggacgcgatctccgcgggc
aacacgatcgcggcgtacctcgccgccgaagacgagttcggcaaccgcgaactcatctgg
gatctcgtcgacaagatcgcccagcgcgacggcgtgggcgatacgctcgcggaggggatc
ggtcggatccacgaggacctcggcgtggggaactggtcggtgaagaacatggacttcgcg
gcccacgaggggcgactcctccacggccaagcgctctcgtacgcggtcgcgaaccgcggc
gccgaccacatgtacgcgacgttctactcggtggaatacccgctcgtcgaggaagcggag
gccatggagcccgccgggttcgaggggaaggccgatcgcctcgtggaacgcgagaacctg
atggcgctcaacgacagcggcgtcgtctgcaagttctcgcgggacttcatgacgcccgag
cgctacgaactgctcttcgacgccgacttcgaggagctgctcgcggcgggcgcccggacg
gtgacgctagagcgtcacttcaacaaccggcgcgggatcgacggcgacgacgaccggctc
ccgtacgaggacgaactgcccgggctcgacgacgccatcgactcgtactacgagcttcgc
gggtggaacgacgacggtacggtgcccgaatcggcgctgccggcgtag

DBGET integrated database retrieval system