KEGG   Halorubrum lacusprofundi: Hlac_1054Help
Entry
Hlac_1054         CDS       T00856                                 

Definition
aminotransferase class-III
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
hla  Halorubrum lacusprofundi
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Hlac_1054
   00650 Butanoate metabolism
    Hlac_1054
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Hlac_1054
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Hlac_1054
Enzymes [BR:hla01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Hlac_1054
Amino acid related enzymes [BR:hla01007]
 Aminotransferase (transaminase)
  Class III
   Hlac_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1049085..1050446)
Genome map
AA seq 453 aa AA seqDB search
MNRDTAEPIADAIPGPNAQRWVEFHQSHSAPSEYSHEFVWDVTREADGPFVTDVDGNVLL
DFTCHIGAAPLGYNNEKVLSKLREFDLVEPLKIAGQDMYFGSGPTPEDADFPGSSHLMET
LTDISSQYGMDTVFLSNSGAEAMENAMKITHDYRAPAKYGVAFTGSFHGRTLGTLSLTKS
KDVYTRQYPQISGIETVPFCADRGCDAASCDCGFFAGGGSRLRNMLAPEGGHVDPAEIAF
LTLEPIQGVGGYRFPSEAFMNEVAAVTDEYDIPLVVDEIQSGVGRTGEMWASDHYAIEPD
VIASAKALRVGATISRSEVFPSEKNRLGSTFGGGDVLGSMMGALTLEAIQEHDLLANATR
RGRQARELLRDDAPDTVVDVRGKGLMLAVEFDTAERRAAVVEASLDRGLLTLGCGTKTIR
LLPPLDATEREIALGTGIFLDAIDAVSASATAT
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaatagggacacggcggaacccatcgcggacgcgattccgggcccgaacgcgcagcgt
tgggtcgaattccaccagtcacactccgcgcccagcgagtactcacacgaattcgtctgg
gacgtgacccgcgaggccgacgggccgttcgtcaccgatgtcgacggcaacgtcctcctc
gattttacctgccacatcggcgcggccccgctcggctacaacaacgagaaggtgctctcg
aaactgcgggagttcgacctcgtcgagccgctgaagatcgccgggcaagacatgtacttc
gggtcgggaccgacgcccgaggacgccgacttccccggatcgagccacctcatggagacg
ttgaccgacatctccagtcagtacgggatggacacggtcttcctctcgaactccggcgct
gaggcgatggagaacgcgatgaagatcacgcacgattaccgcgcccccgcgaagtacggc
gtggcgttcaccgggagcttccacggccgaacgctcgggaccctctcgttgacgaagtcg
aaggacgtgtacacgcgccagtacccccagatcagcggcatcgagacggtgccgttctgt
gcggaccgcggctgcgacgccgcgagctgcgactgcggcttcttcgcgggcggcggctcg
cggcttcggaatatgctcgcgcccgagggcggccacgtcgaccccgcggagatcgccttt
ctgacgctcgaaccgatccagggcgtcggcggctaccgcttcccgagcgaggcgttcatg
aacgaggtcgcggccgtcaccgacgagtacgacatcccgctcgtcgtcgacgagatccag
tccggagtcggccgcacgggcgagatgtgggcgtcggaccactacgccatcgagccggac
gtgatcgcgagcgcgaaggcgctgcgcgtcggcgcgacgatctcccggtcggaggtgttc
ccgtcggagaagaaccgcctcggctcgacgttcggcggcggcgacgtcctcggctcgatg
atgggcgcgctcacgttggaggcgattcaggaacacgacctgctggccaacgcgacccgg
cgtggccggcaggcgagagagctcctccgcgacgacgcgcccgacaccgtcgtggacgtg
cgcggcaaggggctgatgctcgcggtggagttcgacacggccgagcgtcgcgccgccgtc
gtcgaggcgtccctcgaccgcggactcctgacgctcggctgcgggacgaagacgatacgt
ctccttcccccgctcgacgcgaccgaacgcgagatcgcgctcggcacgggaatcttcctc
gacgcgatcgacgccgtgagcgcgagcgcgacggccacctga

DBGET integrated database retrieval system