KEGG   Halorubrum lacusprofundi: Hlac_1272Help
Entry
Hlac_1272         CDS       T00856                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hlac_1272
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hlac_1272
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hlac_1272
Enzymes [BR:hla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hlac_1272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:1282417..1283748
Genome map
AA seq 443 aa AA seqDB search
MSETEPTTNEATSARDGADAATPSRRPGRERGRDDGKFGRYGGQYVPEALMPAIEELTDA
YERYVLGNEDGFMDEFRDRLADFGGRPTPLQRADRLSERYDREVFLKREDLLHGGAHKLN
NALGQVLLAKYMGKERIIAETGAGQHGTATAMAAAHLDMPCEIYMGERDINRQRPNVFRM
KLNGAEVNPVTTGRGTLKEAISETMRDWATTVENTHYVIGSVVGPHPFPVMVRDFQAVIS
EEAREQSIEKTGDLPTDVVACAGGGSNTMGAFADFVDDEAVDLHAVEAGGSTLEVDEEAG
VAPNSASLYAGDEGVLHGARTKLLQDSDGQIMESHSISSGLDYAGVGPELAYLVDEGRVD
PVAVDDDAALEGFHRLSRTEGIIPALETAHAFGFLEEFHEELGERVIVNVSGRGDKDLDA
AIEETDKRDIAGAPDMSMFTGGI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacggaacccacgacgaacgaggcgacgagcgcgagagacggagccgacgcg
gcgacgccgtcgcgacgccccggccgcgagcgcggccgcgacgacgggaagttcggccgc
tacggcggccagtacgtccccgaggcgctgatgcccgccatcgaggagctgacggacgcc
tacgagcgctacgtcctcggcaacgaggacggattcatggacgagttccgcgatcggctc
gcggacttcggcggccgaccgacgccgctccagcgcgccgaccggctctcggagcgctac
gaccgcgaggtgttcctcaaacgcgaggacctcctccacggcggcgcgcacaagctgaac
aacgccctcgggcaggtcctcttggcgaagtacatgggcaaagagcgcatcatcgcggag
acgggcgccggccagcacggcaccgcgaccgcgatggcggccgcccacctcgacatgccc
tgtgagatctacatgggcgagcgcgacatcaaccgccagcgccccaacgtcttccggatg
aagctcaacggcgccgaggtgaacccggtcacgacgggccgaggcaccctgaaggaggcc
atctccgagacgatgcgcgactgggcgaccaccgtcgagaacacccactacgtcatcggc
tcggtcgtcggcccgcacccgttcccggtgatggtccgcgacttccaggcggtcatctcc
gaggaggcgcgcgagcagtcgatcgagaagaccggcgacctcccgaccgacgtggtcgcc
tgcgcgggcggcggctcgaacacgatgggcgcgttcgccgacttcgtcgacgacgaggcg
gtcgatctgcacgcggtcgaggcgggcggctcgacgctggaggtcgacgaggaagcgggc
gtcgccccgaactcggcgtcgctgtacgcgggcgacgagggggtactccacggcgcgcgc
acgaagctcctgcaggactccgacggccagatcatggagagccactcgatctcctccggc
ctcgactacgccggcgtcggcccagagctcgcgtacctcgtcgacgaggggcgcgtggac
ccggtcgccgtcgacgacgacgcggccttggaggggttccaccggctctcgcgcacggag
gggatcatccccgccttggagaccgcgcacgcgttcggcttcttggaagagttccacgag
gaactgggcgagagggtgatcgtgaacgtctccgggcgcggcgacaaggacctcgacgcc
gccatcgaggagacggacaaacgggacatcgccggggcgccggacatgtcgatgttcacg
ggggggatctga

DBGET integrated database retrieval system