KEGG   Halorubrum lacusprofundi: Hlac_1273Help
Entry
Hlac_1273         CDS       T00856                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hlac_1273
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hlac_1273
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hlac_1273
Enzymes [BR:hla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hlac_1273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:1283749..1284663
Genome map
AA seq 304 aa AA seqDB search
MADRTAESAKTGNSEAIAAAFADGPAYIPYLAVGDPDYESSKAYVEALDRGGADIIELGL
PFSEPIAEGSTIQGALVRALDAGMTPDRFFAFAEEVDVEAPLVCMTYYNLIYQYGGEARS
ASDASGETASAGPRPFVERAAAAGIEGLVVPDLPAEEADPLREACDEFGLDLVFIVAPTT
VDDRLDRIMDRVSGYVYVQARLGTTGARSDVSDQTTQSLDRLREYDVPKAVGFGISSGEH
AERIVGGGADGIIVGSALVDIVAEGVEDDLSTAEVADRLEALSRELKAGAERGYAARIEA
AESR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccggaccgcggaatcggcgaagacgggcaactccgaggccatcgcggccgcc
ttcgccgacggccccgcctacatcccgtacctcgcggtcggcgatccggactacgagtcc
tcgaaggcgtacgtcgaggcgctcgaccgcggcggcgcggacatcatcgaactcggactc
ccgttctcggagccgatcgcggaggggtcgaccattcagggggcgctggtccgcgcgctc
gacgccgggatgacgccggaccggttcttcgcgttcgcggaggaggtggacgttgaggcg
ccgctcgtctgcatgacgtactacaacctcatttaccaatacggcggcgaggcgcggagc
gcctcggatgcgagcggtgaaaccgcgagcgccggcccccgtcccttcgtcgagcgcgcc
gctgcggccggcatcgaagggctcgtcgtccccgacctcccggccgaggaggccgacccc
ctgcgagaggcgtgcgacgagttcgggctcgacttggtcttcatcgtcgcgcccaccacg
gtcgacgaccggctcgatcggatcatggacagggtgtccggctacgtctacgtgcaggcg
cgcctcgggaccaccggcgcgcgcagcgacgtgtccgaccagaccacgcagagcttagat
cggctccgtgagtacgacgtgccgaaggccgtcgggttcggcatctcatcgggcgagcac
gcggagcgcatcgtgggcggcggcgccgacgggatcatcgtcggctcggcgctcgtcgac
atcgtcgccgagggcgtcgaggacgacctctcgaccgccgaggtcgccgaccggctggag
gcgctctcacgggaactgaaggcgggcgccgaacgcggctacgccgcgcgcatcgaggcg
gcggagtcgcggtga

DBGET integrated database retrieval system