KEGG   Halorubrum lacusprofundi: Hlac_1273Help
Entry
Hlac_1273         CDS       T00856                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00260  Glycine, serine and threonine metabolism
hla00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01130  Biosynthesis of antibiotics
hla01230  Biosynthesis of amino acids
Module
hla_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hlac_1273
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hlac_1273
Enzymes [BR:hla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hlac_1273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ACM56865
JGI: Hlac1273
UniProt: B9LNC7
Position
1:1283749..1284663
Genome map
AA seq 304 aa AA seqDB search
MADRTAESAKTGNSEAIAAAFADGPAYIPYLAVGDPDYESSKAYVEALDRGGADIIELGL
PFSEPIAEGSTIQGALVRALDAGMTPDRFFAFAEEVDVEAPLVCMTYYNLIYQYGGEARS
ASDASGETASAGPRPFVERAAAAGIEGLVVPDLPAEEADPLREACDEFGLDLVFIVAPTT
VDDRLDRIMDRVSGYVYVQARLGTTGARSDVSDQTTQSLDRLREYDVPKAVGFGISSGEH
AERIVGGGADGIIVGSALVDIVAEGVEDDLSTAEVADRLEALSRELKAGAERGYAARIEA
AESR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccggaccgcggaatcggcgaagacgggcaactccgaggccatcgcggccgcc
ttcgccgacggccccgcctacatcccgtacctcgcggtcggcgatccggactacgagtcc
tcgaaggcgtacgtcgaggcgctcgaccgcggcggcgcggacatcatcgaactcggactc
ccgttctcggagccgatcgcggaggggtcgaccattcagggggcgctggtccgcgcgctc
gacgccgggatgacgccggaccggttcttcgcgttcgcggaggaggtggacgttgaggcg
ccgctcgtctgcatgacgtactacaacctcatttaccaatacggcggcgaggcgcggagc
gcctcggatgcgagcggtgaaaccgcgagcgccggcccccgtcccttcgtcgagcgcgcc
gctgcggccggcatcgaagggctcgtcgtccccgacctcccggccgaggaggccgacccc
ctgcgagaggcgtgcgacgagttcgggctcgacttggtcttcatcgtcgcgcccaccacg
gtcgacgaccggctcgatcggatcatggacagggtgtccggctacgtctacgtgcaggcg
cgcctcgggaccaccggcgcgcgcagcgacgtgtccgaccagaccacgcagagcttagat
cggctccgtgagtacgacgtgccgaaggccgtcgggttcggcatctcatcgggcgagcac
gcggagcgcatcgtgggcggcggcgccgacgggatcatcgtcggctcggcgctcgtcgac
atcgtcgccgagggcgtcgaggacgacctctcgaccgccgaggtcgccgaccggctggag
gcgctctcacgggaactgaaggcgggcgccgaacgcggctacgccgcgcgcatcgaggcg
gcggagtcgcggtga

DBGET integrated database retrieval system