KEGG   Halorubrum lacusprofundi: Hlac_1304Help
Entry
Hlac_1304         CDS       T00856                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hlac_1304
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_1304
   00620 Pyruvate metabolism
    Hlac_1304
   00640 Propanoate metabolism
    Hlac_1304
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hlac_1304
   00680 Methane metabolism
    Hlac_1304
Enzymes [BR:hla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hlac_1304
Lipid biosynthesis proteins [BR:hla01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hlac_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1313996..1315954
Genome map
AA seq 652 aa AA seqDB search
MDYAGVDGRRTNGLEDGDDAVEPPAGFSDRAVASDAGLYEAFAEEGPEAWRRAADLLDWE
RPSETVLDDSDPPFYEWFPDGRLNAAANCVDRHLDERRNQLAIRWFGKRGERRSYTYLDL
HREVNALAAGLRDLGVEEDDVVTLYLPMVPELPIAMLACARIGAPHNVVFAGLSAEALAT
RIDAADSEYLVTCDGYYRREDAFNQKSKADNARLRADVDLSETVVVDRLGDALDVPLGDD
EHEYEAIVDAHDGETVEPVARDATDLLFVMYTSGTTGRPKGVEHATGGYLSHVAWTTRNV
LDVRPDDTYWCAADIGWITGHSYGVYGPLSVGTTTLLYEGSPDYPDRDRVWDLIERNAVS
VFYTSPTAIRSFMKWGAEYPEAHDLSSIRLLGTVGESITPKAWHWYRKHVGGGEAPIVDT
WWQTETGAISLATLPGITPMKPGKVGPPLPGIDARVVDEDGDPVEPGEPGYLTIAAPWPG
MLRGLREGDERYRREYWLEGDDGWRYRTGDGATVDEDGYVTILGRVDDVINVRTHRFNTA
ELESAIVGADGVTEAAVVGDDDGKIVAYVTTRGDIDPDESLRETIGERLAQAVGDVARPD
RIVFTPDLPKTRSGKIMRRLLEDIARGDEFGDVSALRNPEVVGEIESAVREE
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggattacgccggagttgacggccggcggacgaacgggctcgaagacggcgacgacgcc
gtcgagccgccggccgggttcagcgatcgggccgtcgccagcgacgcgggactgtacgag
gccttcgccgaggaaggacctgaggcgtggcgccgcgccgccgacctgctcgactgggag
cgtccctccgagaccgtcctcgacgacagcgatccgcccttctacgagtggtttccggac
gggcggctcaacgccgcggccaactgcgtcgaccgccacctcgacgagcgccggaaccag
ctcgcgatccgctggttcggcaagcgcggagagcgccggtcgtacacctatctcgacctc
caccgcgaagtgaacgcgctcgcggccggcctccgcgatctgggggtcgaagaggacgac
gtggtgacgctgtacctcccgatggttcccgaactgccgatcgcgatgctggcgtgtgcc
cggatcggggcgcctcataacgtcgtcttcgcggggctgtcggcggaggcgctcgcgacc
cggatcgacgccgccgactcggagtacctcgtcacctgcgacggctactatcgccgtgag
gacgcgttcaaccagaagtcgaaggcggacaacgcccgactccgggccgacgtcgacctg
tccgagacggtggtcgtcgaccggctcggcgacgcgctcgacgtgccgctgggcgacgac
gaacacgagtacgaggcgatcgtggacgcacacgacggagagaccgtcgagccggtcgcg
cgcgacgccaccgacctcctcttcgtgatgtacacctccgggaccacgggtcgtccgaaa
ggcgtcgagcacgcgaccggggggtacctctcgcacgtcgcgtggacgacccggaacgtg
ctcgacgtgcgccccgacgacacctactggtgtgcggccgacatcggctggatcacgggg
cactcctacggcgtgtacggtcccctctccgtcgggaccacgaccctcctctacgagggg
tcacccgactaccccgaccgcgaccgcgtgtgggacctgatcgagcgcaacgccgtcagc
gtcttttacacctcgccgaccgcgattcgctcgtttatgaagtggggcgcggagtacccc
gaggcccacgacctgtcgtcgatccgcctgttggggaccgtcggcgagtcgatcactccg
aaggcgtggcactggtaccgcaagcacgtcggcggaggcgaggcgccgatcgtcgacacg
tggtggcagaccgagacgggcgccatctccctcgcgaccctgccggggatcacgccgatg
aaacccggcaaggtcggcccgccgctgccggggatcgacgcgcgcgtcgtcgacgaggac
ggcgatccggtcgagcccggcgagccggggtacctcacgatcgccgctccgtggcccggc
atgctccgcgggctccgcgagggcgacgagcggtaccgccgggagtactggctggagggc
gacgacgggtggcggtaccgcaccggcgacggcgccaccgtcgacgaggacggctacgtg
acgatcctcggccgcgtcgacgacgtgatcaacgtccggacgcaccgattcaacaccgcg
gagctggagtcagccatcgtcggggccgacggcgtcaccgaggccgcggtcgtcggcgac
gacgacgggaagatcgtcgcgtacgtgacgactcggggcgacatcgaccccgatgaatcc
ctccgcgagacgatcggcgagcggctggcgcaggcggtcggcgacgtggcgcgccccgac
cggatcgtgttcacccctgacctcccgaagacgcggtccgggaagatcatgcgccgcctt
ctggaggacatcgcgcgcggtgacgagtttggcgacgtgagcgccctccgcaaccccgag
gtcgtcggcgagatcgagtcggcggttcgcgaggagtaa

DBGET integrated database retrieval system