KEGG   Halorubrum lacusprofundi: Hlac_1306Help
Entry
Hlac_1306         CDS       T00856                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00010  Glycolysis / Gluconeogenesis
hla00620  Pyruvate metabolism
hla00640  Propanoate metabolism
hla00680  Methane metabolism
hla00720  Carbon fixation pathways in prokaryotes
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01120  Microbial metabolism in diverse environments
hla01130  Biosynthesis of antibiotics
hla01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_1306
   00620 Pyruvate metabolism
    Hlac_1306
   00640 Propanoate metabolism
    Hlac_1306
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hlac_1306
   00680 Methane metabolism
    Hlac_1306
Enzymes [BR:hla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hlac_1306
Lipid biosynthesis proteins [BR:hla01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hlac_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACM56898
JGI: Hlac1306
UniProt: B9LNG0
Position
1:1318122..1320116
Genome map
AA seq 664 aa AA seqDB search
MTEGDGQLEARLAEQEVFEPPESFVEQANVSDSGVYDEFEENWPECWEGAADLLDWESDY
DQVLDDSNPPFYEWFTGGELNASANCLDRHLDDRGDEVAIEWIGEPVDEDDRSYTYAELH
REVNEFAAALRDQGVEEDDVVTMYMPMIPELPIAMLACARIGAPHSVVFAGFSADALATR
MNSAESEYLVTCDGYYRRGDPLDHLDKANQGLAGVEHDTTTVVVDRLGPNGDDFGHDLGD
DQIDYGDLVADHEGAEVDPVTRDAEDMLFLMYTSGTTGKPKGVKHTTGGYLSWVSWTSQS
VLDIKPDDTYFCSADIGWITGHSYIVYGPLSLGTTTMMYEGTPDHPERDRLWEIVDEYDA
TQLYTAPTAIRAFMKWGAKYPDAHDLSSLRLLGTVGEPINPRAWKWYYKHIGDEECPIVD
TWWQTETGGMMITTLPGIKDMKPGAAGPPLPGLDVQILDTLGDEVEPGKAGYLTVQKPWP
GMLRTLYNNDERYIDEYWAEYSDTDSDDPDDWVYFPEDGAKIDEDGYITVLGRVDDVLNV
SGHRLGTMEIESAIVGVEGVAEAAVVGGNHDIKGEAVYAYVTTEDGYEGNDELRDAIITG
VEDAIGPIARPEQVVFTPDLPKTRSGKIMRRLLENIADGEELGNTSTLRNPEIVEEIQQK
AKGE
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgacagagggagacggtcaacttgaagcgagattagcagagcaggaggtgttcgagccg
ccggagtccttcgttgagcaggcgaacgtctcggattccggcgtctacgacgagttcgag
gagaactggccagagtgctgggagggggcggctgacctgctcgactgggaatccgactac
gaccaggtgctcgacgacagcaaccctcccttctacgagtggttcacgggcggcgagctg
aacgcgtcggccaactgcctcgaccgacacctcgacgaccgcggcgacgaggtcgccatc
gagtggatcggtgagcccgtcgacgaggacgaccggtcgtacacctacgcggagctgcac
cgcgaggtaaacgagttcgcggccgcgctccgcgatcagggcgtcgaggaggacgacgtg
gtgacgatgtacatgccgatgattccggagctgccgatcgcgatgctggcgtgcgcccga
atcggcgcgccccacagcgtcgtgttcgccggattctcggcggacgcgctcgcgacgcgg
atgaactccgcggagtcggagtacctcgtcacctgcgacggctactaccgccgcggcgat
cccctcgaccacctcgacaaggcgaaccaagggctcgcgggcgtcgagcacgacacgacc
acggtcgtcgtcgaccggctcggcccgaacggcgacgacttcggccacgacctaggcgac
gatcagatcgactacggcgacctcgtcgcggaccacgagggcgccgaggtcgacccggtc
acgcgcgacgccgaggacatgctgttcctgatgtacacctcgggaacgaccgggaagccg
aagggcgtgaaacacacgaccgggggctatctctcgtgggtatcgtggacctcgcagtcg
gtcctcgatatcaagccggatgacacgtacttctgttcggccgacatcggctggatcacg
ggtcactcgtacatcgtctacgggccgctctcgctcgggacgacgacgatgatgtacgag
gggacgcccgatcacccggagcgcgatcgcctctgggagatcgtcgacgagtacgacgcg
acccaactgtacaccgcacccaccgcgatccgcgcgttcatgaagtggggcgcgaagtac
cccgacgcccacgacctctcctcgctgcggctgctcggcacggtcggcgagccgatcaat
ccgcgcgcgtggaagtggtactacaagcacatcggcgacgaggagtgcccgatcgtcgac
acgtggtggcagaccgagaccggcgggatgatgatcacgacgctgcccgggatcaaggat
atgaaaccgggcgccgcggggccgccgctcccgggcctcgacgtacagatcctcgacacg
ctcggcgacgaggtcgagccggggaaggccggctacctcacggtacagaaaccgtggccc
ggcatgctccggacgctgtacaacaacgacgagcgctacatcgacgagtactgggcggag
tactccgacaccgacagcgacgatcccgacgactgggtgtacttcccggaggacggcgcc
aagatcgacgaggacgggtacatcaccgttctcggccgcgtcgacgacgtgctcaacgtc
tcgggccaccggctggggacgatggagatcgagtccgccatcgtcggcgtcgagggcgtc
gccgaggcggccgtcgtcggcggcaaccacgacatcaaaggtgaggccgtctacgcgtac
gtgaccaccgaggacgggtacgagggcaacgacgagctccgcgacgcgatcatcacgggc
gtcgaagacgccatcggcccgatcgcccggccggagcaggtcgtgttcacgcccgacctg
ccgaagacccgatccggaaagatcatgcgccgcctgcttgagaacatcgccgacggggaa
gagctgggtaataccagcacgctccggaacccggagatcgtcgaagagatccagcagaag
gccaagggcgagtag

DBGET integrated database retrieval system