KEGG   Halorubrum lacusprofundi: Hlac_1306Help
Entry
Hlac_1306         CDS       T00856                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hla01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hla00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hla00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hla00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:hla00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1318122..1320116
Genome map
AA seq 664 aa AA seqDB search
MTEGDGQLEARLAEQEVFEPPESFVEQANVSDSGVYDEFEENWPECWEGAADLLDWESDY
DQVLDDSNPPFYEWFTGGELNASANCLDRHLDDRGDEVAIEWIGEPVDEDDRSYTYAELH
REVNEFAAALRDQGVEEDDVVTMYMPMIPELPIAMLACARIGAPHSVVFAGFSADALATR
MNSAESEYLVTCDGYYRRGDPLDHLDKANQGLAGVEHDTTTVVVDRLGPNGDDFGHDLGD
DQIDYGDLVADHEGAEVDPVTRDAEDMLFLMYTSGTTGKPKGVKHTTGGYLSWVSWTSQS
VLDIKPDDTYFCSADIGWITGHSYIVYGPLSLGTTTMMYEGTPDHPERDRLWEIVDEYDA
TQLYTAPTAIRAFMKWGAKYPDAHDLSSLRLLGTVGEPINPRAWKWYYKHIGDEECPIVD
TWWQTETGGMMITTLPGIKDMKPGAAGPPLPGLDVQILDTLGDEVEPGKAGYLTVQKPWP
GMLRTLYNNDERYIDEYWAEYSDTDSDDPDDWVYFPEDGAKIDEDGYITVLGRVDDVLNV
SGHRLGTMEIESAIVGVEGVAEAAVVGGNHDIKGEAVYAYVTTEDGYEGNDELRDAIITG
VEDAIGPIARPEQVVFTPDLPKTRSGKIMRRLLENIADGEELGNTSTLRNPEIVEEIQQK
AKGE
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgacagagggagacggtcaacttgaagcgagattagcagagcaggaggtgttcgagccg
ccggagtccttcgttgagcaggcgaacgtctcggattccggcgtctacgacgagttcgag
gagaactggccagagtgctgggagggggcggctgacctgctcgactgggaatccgactac
gaccaggtgctcgacgacagcaaccctcccttctacgagtggttcacgggcggcgagctg
aacgcgtcggccaactgcctcgaccgacacctcgacgaccgcggcgacgaggtcgccatc
gagtggatcggtgagcccgtcgacgaggacgaccggtcgtacacctacgcggagctgcac
cgcgaggtaaacgagttcgcggccgcgctccgcgatcagggcgtcgaggaggacgacgtg
gtgacgatgtacatgccgatgattccggagctgccgatcgcgatgctggcgtgcgcccga
atcggcgcgccccacagcgtcgtgttcgccggattctcggcggacgcgctcgcgacgcgg
atgaactccgcggagtcggagtacctcgtcacctgcgacggctactaccgccgcggcgat
cccctcgaccacctcgacaaggcgaaccaagggctcgcgggcgtcgagcacgacacgacc
acggtcgtcgtcgaccggctcggcccgaacggcgacgacttcggccacgacctaggcgac
gatcagatcgactacggcgacctcgtcgcggaccacgagggcgccgaggtcgacccggtc
acgcgcgacgccgaggacatgctgttcctgatgtacacctcgggaacgaccgggaagccg
aagggcgtgaaacacacgaccgggggctatctctcgtgggtatcgtggacctcgcagtcg
gtcctcgatatcaagccggatgacacgtacttctgttcggccgacatcggctggatcacg
ggtcactcgtacatcgtctacgggccgctctcgctcgggacgacgacgatgatgtacgag
gggacgcccgatcacccggagcgcgatcgcctctgggagatcgtcgacgagtacgacgcg
acccaactgtacaccgcacccaccgcgatccgcgcgttcatgaagtggggcgcgaagtac
cccgacgcccacgacctctcctcgctgcggctgctcggcacggtcggcgagccgatcaat
ccgcgcgcgtggaagtggtactacaagcacatcggcgacgaggagtgcccgatcgtcgac
acgtggtggcagaccgagaccggcgggatgatgatcacgacgctgcccgggatcaaggat
atgaaaccgggcgccgcggggccgccgctcccgggcctcgacgtacagatcctcgacacg
ctcggcgacgaggtcgagccggggaaggccggctacctcacggtacagaaaccgtggccc
ggcatgctccggacgctgtacaacaacgacgagcgctacatcgacgagtactgggcggag
tactccgacaccgacagcgacgatcccgacgactgggtgtacttcccggaggacggcgcc
aagatcgacgaggacgggtacatcaccgttctcggccgcgtcgacgacgtgctcaacgtc
tcgggccaccggctggggacgatggagatcgagtccgccatcgtcggcgtcgagggcgtc
gccgaggcggccgtcgtcggcggcaaccacgacatcaaaggtgaggccgtctacgcgtac
gtgaccaccgaggacgggtacgagggcaacgacgagctccgcgacgcgatcatcacgggc
gtcgaagacgccatcggcccgatcgcccggccggagcaggtcgtgttcacgcccgacctg
ccgaagacccgatccggaaagatcatgcgccgcctgcttgagaacatcgccgacggggaa
gagctgggtaataccagcacgctccggaacccggagatcgtcgaagagatccagcagaag
gccaagggcgagtag

DBGET integrated database retrieval system