KEGG   Halorubrum lacusprofundi: Hlac_1306Help
Entry
Hlac_1306         CDS       T00856                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hlac_1306
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_1306
   00620 Pyruvate metabolism
    Hlac_1306
   00640 Propanoate metabolism
    Hlac_1306
  Energy metabolism
   00680 Methane metabolism
    Hlac_1306
Enzymes [BR:hla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hlac_1306
Lipid biosynthesis proteins [BR:hla01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hlac_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1318122..1320116
Genome map
AA seq 664 aa AA seqDB search
MTEGDGQLEARLAEQEVFEPPESFVEQANVSDSGVYDEFEENWPECWEGAADLLDWESDY
DQVLDDSNPPFYEWFTGGELNASANCLDRHLDDRGDEVAIEWIGEPVDEDDRSYTYAELH
REVNEFAAALRDQGVEEDDVVTMYMPMIPELPIAMLACARIGAPHSVVFAGFSADALATR
MNSAESEYLVTCDGYYRRGDPLDHLDKANQGLAGVEHDTTTVVVDRLGPNGDDFGHDLGD
DQIDYGDLVADHEGAEVDPVTRDAEDMLFLMYTSGTTGKPKGVKHTTGGYLSWVSWTSQS
VLDIKPDDTYFCSADIGWITGHSYIVYGPLSLGTTTMMYEGTPDHPERDRLWEIVDEYDA
TQLYTAPTAIRAFMKWGAKYPDAHDLSSLRLLGTVGEPINPRAWKWYYKHIGDEECPIVD
TWWQTETGGMMITTLPGIKDMKPGAAGPPLPGLDVQILDTLGDEVEPGKAGYLTVQKPWP
GMLRTLYNNDERYIDEYWAEYSDTDSDDPDDWVYFPEDGAKIDEDGYITVLGRVDDVLNV
SGHRLGTMEIESAIVGVEGVAEAAVVGGNHDIKGEAVYAYVTTEDGYEGNDELRDAIITG
VEDAIGPIARPEQVVFTPDLPKTRSGKIMRRLLENIADGEELGNTSTLRNPEIVEEIQQK
AKGE
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgacagagggagacggtcaacttgaagcgagattagcagagcaggaggtgttcgagccg
ccggagtccttcgttgagcaggcgaacgtctcggattccggcgtctacgacgagttcgag
gagaactggccagagtgctgggagggggcggctgacctgctcgactgggaatccgactac
gaccaggtgctcgacgacagcaaccctcccttctacgagtggttcacgggcggcgagctg
aacgcgtcggccaactgcctcgaccgacacctcgacgaccgcggcgacgaggtcgccatc
gagtggatcggtgagcccgtcgacgaggacgaccggtcgtacacctacgcggagctgcac
cgcgaggtaaacgagttcgcggccgcgctccgcgatcagggcgtcgaggaggacgacgtg
gtgacgatgtacatgccgatgattccggagctgccgatcgcgatgctggcgtgcgcccga
atcggcgcgccccacagcgtcgtgttcgccggattctcggcggacgcgctcgcgacgcgg
atgaactccgcggagtcggagtacctcgtcacctgcgacggctactaccgccgcggcgat
cccctcgaccacctcgacaaggcgaaccaagggctcgcgggcgtcgagcacgacacgacc
acggtcgtcgtcgaccggctcggcccgaacggcgacgacttcggccacgacctaggcgac
gatcagatcgactacggcgacctcgtcgcggaccacgagggcgccgaggtcgacccggtc
acgcgcgacgccgaggacatgctgttcctgatgtacacctcgggaacgaccgggaagccg
aagggcgtgaaacacacgaccgggggctatctctcgtgggtatcgtggacctcgcagtcg
gtcctcgatatcaagccggatgacacgtacttctgttcggccgacatcggctggatcacg
ggtcactcgtacatcgtctacgggccgctctcgctcgggacgacgacgatgatgtacgag
gggacgcccgatcacccggagcgcgatcgcctctgggagatcgtcgacgagtacgacgcg
acccaactgtacaccgcacccaccgcgatccgcgcgttcatgaagtggggcgcgaagtac
cccgacgcccacgacctctcctcgctgcggctgctcggcacggtcggcgagccgatcaat
ccgcgcgcgtggaagtggtactacaagcacatcggcgacgaggagtgcccgatcgtcgac
acgtggtggcagaccgagaccggcgggatgatgatcacgacgctgcccgggatcaaggat
atgaaaccgggcgccgcggggccgccgctcccgggcctcgacgtacagatcctcgacacg
ctcggcgacgaggtcgagccggggaaggccggctacctcacggtacagaaaccgtggccc
ggcatgctccggacgctgtacaacaacgacgagcgctacatcgacgagtactgggcggag
tactccgacaccgacagcgacgatcccgacgactgggtgtacttcccggaggacggcgcc
aagatcgacgaggacgggtacatcaccgttctcggccgcgtcgacgacgtgctcaacgtc
tcgggccaccggctggggacgatggagatcgagtccgccatcgtcggcgtcgagggcgtc
gccgaggcggccgtcgtcggcggcaaccacgacatcaaaggtgaggccgtctacgcgtac
gtgaccaccgaggacgggtacgagggcaacgacgagctccgcgacgcgatcatcacgggc
gtcgaagacgccatcggcccgatcgcccggccggagcaggtcgtgttcacgcccgacctg
ccgaagacccgatccggaaagatcatgcgccgcctgcttgagaacatcgccgacggggaa
gagctgggtaataccagcacgctccggaacccggagatcgtcgaagagatccagcagaag
gccaagggcgagtag

DBGET integrated database retrieval system