KEGG   Halorubrum lacusprofundi: Hlac_1387Help
Entry
Hlac_1387         CDS       T00856                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hla  Halorubrum lacusprofundi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hla00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1396004..1397221
Genome map
AA seq 405 aa AA seqDB search
MRNVDAAGLEIGDDHPPRIMGVLNVSAESPYDPSVYDDPGEAAEYVDEELIGEGADIVDV
GLESANKDLDVLSAEQELDRLDTAIETLESTSGDAVWSIETRYHEVADEALARGFDMVND
ICGFADPEMPRVCREHDAAVSKMASPPDLERPGAIEDVDEIYEALSMNGLTDKTILDPAF
GGWSKAKTHADDRETFHRLREFRGYGRPLLVSINRKSFLKTIAGRSTEEALPVSLAATSM
AVERGAHVIRTHDVAETRDAALVGAEFARDRVRSDDGPSDIAVEELDVTTVREAERHLDR
LDADQSVAGDAAVRTYELRGLTDEAVGALRAATAEPGVGAAFALAGSDAAETAVPPSATD
GGAPTNGESGLLVGTVAALSAVRSAVSGVSDALDAALESIDDGSK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaacgtggacgccgcggggctcgagatcggcgacgaccacccgcctcggatcatg
ggcgtactcaacgtctccgcggagtcgccgtacgacccgagcgtgtacgacgacccgggc
gaggccgccgagtacgtcgacgaggagctgatcggcgagggcgccgacatcgtcgacgtc
gggctcgaatcggccaacaaggacttagacgtgctctcggccgaacaggagttggatcgg
ctcgacaccgcgatcgagacgctggagtcgacctcgggcgacgccgtctggtcgatcgag
acccgctaccacgaggtcgccgacgaggcgcttgcacgcgggttcgacatggtcaacgac
atctgcggcttcgccgatcccgagatgccccgcgtctgccgcgaacacgacgcggccgtc
tcgaagatggcctcgccgccagatctggagcgaccgggtgccatcgaggacgtggacgag
atctacgaagcgctgtcgatgaacggcctcaccgacaagacgatcctcgaccccgcgttc
ggtggctggtcgaaggcaaaaacccacgccgacgaccgcgagacgttccaccggctacgg
gagttccgcggctacggtcgcccgctgctcgtctcgatcaaccgcaagagcttcctcaag
acgatcgcgggacggagtaccgaggaggcccttccggtgtcgctcgccgccacctcgatg
gcagtcgagcgcggcgcacacgtgatccgcacccacgatgtggccgagacgcgggacgcg
gcactcgtcggcgccgagttcgcccgcgatcgggtccgttcggacgacgggcccagcgac
atcgccgtcgaggaactcgacgtgacgaccgttcgggaggccgagcgccacctcgaccgg
ctggacgccgaccagtccgtcgccggcgacgcggccgttcgcacctacgagctacgcggg
ctcaccgacgaggccgtcggcgcgctccgagcggcgaccgccgagcccggcgtcggcgcg
gcgttcgccctcgccggttccgacgccgccgagaccgcggttcccccctcggccaccgac
ggcggggcccccacaaatggcgaatccggactgctcgtcggaacagtagccgcgctgtct
gcggttcgatcggccgtttcgggcgtttcagacgcgctcgacgccgcgctggaatcgatc
gacgacggctccaagtaa

DBGET integrated database retrieval system