KEGG   Halorubrum lacusprofundi: Hlac_1480Help
Entry
Hlac_1480         CDS       T00856                                 

Definition
histone acetyltransferase, ELP3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hla  Halorubrum lacusprofundi
Brite
Enzymes [BR:hla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Hlac_1480
Transfer RNA biogenesis [BR:hla03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Hlac_1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1488589..1490346)
Genome map
AA seq 585 aa AA seqDB search
MSTDAASDGDAGSEGGDAGGGSGSEATGDEPEAFVRACEYLVDRILAGEIDRDDLESAKL
DACSKFSSPKVPKNTEILDHAPTEARDDVIEVVQRKPVRTASGVSPVAIMTSPKLCPHGK
CLYCPGGPASEFSSAQSYTGHEPAAARGEQNDYDPYGQVTLRLEQLRKIGHPVDKVELIL
MGGTMTARSHDYQEWFVKRALQAMNDYDLDKEPEPAEGESFAPAPEETEFEYLEDVIAEN
ETNEIRNIGTTFETKPDWCDPEQIDRMLDLGGTKVEVGVQTTYERINREMHRGHGNEASR
NANRHLRDAAFKVGFHMMPGQPGMTREMCVEDFRQIFENPDWRPDYLKIYPTLVVEGTRV
YDRWRQDSFEPLSNEEAADVVADAMDQIPKYTRLQRVQRDIPADFIEGGVWKSNLRQLAD
QRAEEKGIVQRDIRAREVGHNDADPDPDDVELDVLTYEAGGGTEHFISFEDPVRDLLVGF
CRLRFPSFAPDQPGAPGTEDDPIRRELEDAALIRELHVYGSEVAIGGAGDWQHQGYGTKL
LERAEELARDAGYRKLAIISGIGAREYYRNKLGYHQDGPYVSKRL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgacgcggcgagtgacggcgacgccggaagcgagggcggcgacgccggaggg
ggatccggcagcgaggcgaccggcgacgagcccgaggcgttcgtccgggcctgcgagtac
ctcgtcgaccggatcctcgcgggcgagatcgatcgcgacgacctcgagtccgccaagctc
gacgcctgctcgaaattctcctcgccgaaggtcccgaagaacaccgaaatcttggaccat
gcccccaccgaggcgcgcgacgacgtgatcgaggtggtccagcggaagccggttcggacc
gcctccggcgtctcgccggtcgcgatcatgacctcgccgaagctgtgcccgcacgggaag
tgcctgtactgtcccggcgggccggcctcggagttctcctcggcgcagtcgtacacgggc
cacgagcccgccgcggcccggggcgagcagaacgactacgacccgtacggacaggtcacg
ctccggctcgaacagctccgcaagatcggtcacccggtcgacaaggtggagctcatcctg
atgggcgggacgatgaccgcgcgctcacacgactaccaggagtggttcgtgaagcgcgcc
ttacaggcgatgaacgactacgacctcgacaaagagcccgagcccgccgagggcgagtcg
ttcgcgcccgcccccgaagagaccgagttcgagtacctcgaagacgtgatcgccgaaaac
gagaccaacgagatccgcaacatcggcacgacgttcgagacgaagccggactggtgcgat
ccggaacagatcgaccgcatgctcgatctgggggggaccaaggtggaggtcggcgtccag
accacctacgagcggatcaaccgcgagatgcaccgcgggcacggcaatgaggcttcccgc
aacgccaaccgccacctacgcgacgccgcgttcaaggtcgggttccacatgatgccgggc
cagccggggatgacccgagagatgtgcgtcgaggacttccgccagatcttcgagaacccc
gactggcggccagactacctgaagatctatccaaccctcgtcgtcgaggggacccgcgtg
tacgaccggtggcgccaggactcgttcgagccgctctcgaacgaggaggcggccgatgtg
gtcgccgacgcgatggaccagatcccgaagtacacccggctccagcgcgtccagcgcgac
attccggccgacttcatcgagggcggcgtctggaagtcgaacctccgacagctcgccgac
cagcgggccgaggagaaagggatcgtccagcgcgatatccgtgcccgcgaggtgggccac
aacgacgccgacccggaccccgacgacgtggaactcgacgtgctcacctacgaggccggc
ggcgggacggaacacttcatctccttcgaagaccccgtccgcgacctgctcgtcgggttc
tgtcgcctgcggttcccctccttcgcgcccgaccagcccggcgcgcccggcaccgaggac
gacccgatccgccgcgagcttgaggacgccgcgctgatccgcgaactccacgtgtacggc
agcgaggtcgccatcggcggcgccggcgactggcagcatcaggggtacgggacgaagctc
ctcgaacgcgccgaggaactggcccgcgacgccggctaccgcaagctggcgatcatctcc
gggatcggggcccgggagtactaccgaaacaagctcggctaccaccaggacgggccgtac
gtctcgaagcggctgtag

DBGET integrated database retrieval system