KEGG   Halorubrum lacusprofundi: Hlac_1505Help
Entry
Hlac_1505         CDS       T00856                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hla  Halorubrum lacusprofundi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hlac_1505
Enzymes [BR:hla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Hlac_1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1517793..1519283
Genome map
AA seq 496 aa AA seqDB search
MRLDRSSGVFCHVTSLPGRHGIGDLGDGAKAFLSFLGDADIGHWQVCPLGPTMGAAGESP
YQSPSAFAGNPLLIDLDGLVDDGWLDESDLEPIPDFPEDRVDYDAVREYKQPLLRTAFER
FDEAEAGKAHSEFDAFREREPWLDDYALFRAMSGERDDDTWVEWPDPLRTREPEALDEAR
ERHATEVRFGEFLQWMFDRQWRDLRAVAADEGVSIVGDVPIYVALDSADVWANPEAFRLD
EGNRPAVVAGVPPNPGDDGQRWGNPVYDWDRLAERDYDWWIARFRRLFELADVARLDHFL
GFVKYWAIPADADDPAAGEWCEGPGRDLFETVERELGQAPFIAEDLGFEEPAMDELMVEF
GFPGMRVPQYADWCAEGNQYQPMHYPEGVVGYTSTHDTDTWVGYFEGLPERQRDCFRYNV
GADGDRPPEWEIIDEVWASEAVLAMTTVQDLLGLGSESRFNEPGTLNGNWEWRVRRDALD
DAIADRLWDLAGRHVR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcgactcgatcgctccagcggcgtgttctgtcacgtcacctcgctcccggggagacac
ggtatcggcgacctcggcgacggggcgaaggcgttcctctcgtttctcggcgacgccgac
atcggccactggcaggtctgcccgctcgggccgacaatgggcgccgccggggagtccccg
taccaatcgccctccgcgttcgccggcaatcctctcctgatcgacctcgacgggctcgtc
gatgacggctggcttgacgagtcggacctcgaaccgattcccgactttccagaggatcgg
gtcgactacgacgcggtccgcgagtacaaacagccgctgttgcggaccgccttcgagcgg
ttcgatgaggccgaggccgggaaggctcactccgagttcgacgcattccgcgagcgcgag
ccgtggctcgacgactacgcgctgttccgggcgatgtctggcgagagagacgatgacacg
tgggtcgagtggcccgacccgctccggacccgagagcccgaggcgctcgacgaagcccgc
gagcgccacgcgaccgaggttcggttcggagagttcctccagtggatgttcgaccggcag
tggcgcgaccttcgggcggtcgccgccgacgagggcgtgtcgatcgtcggcgacgtgccc
atctacgtcgcgctcgactccgcggacgtgtgggcgaaccccgaggcgttccggctcgac
gaggggaaccgccccgcggtcgtcgcgggcgtcccgccgaacccgggcgacgacgggcag
cgctgggggaaccccgtctacgactgggatcggcttgccgagcgcgactacgactggtgg
atcgcccggttccggcgactgttcgaactcgccgacgtggcccgactcgaccacttcctc
gggttcgtgaagtactgggcgatccccgccgacgccgacgacccggccgccggtgagtgg
tgtgaggggccgggacgcgacctgtttgagactgtagagcgcgagctggggcaggcgccc
ttcatcgccgaggacctcgggttcgaggagccggcgatggacgagctgatggtggagttc
ggcttccccgggatgcgcgttccgcagtacgccgactggtgtgcggaggggaaccagtac
cagccgatgcactaccccgagggggtcgtcggctacacgtcgacccacgacacggacacg
tgggtcggctacttcgagggtctgccagagcgccagcgcgactgcttccggtacaacgtc
ggcgccgacggcgaccgcccaccggagtgggagatcatcgacgaggtgtgggcctcggag
gcggtgctggcgatgacgacggtccaagatctgctcgggctcgggagcgaatcgcggttc
aacgagccgggaaccctcaatggcaactgggagtggcgcgtccgtcgcgacgcgctcgac
gacgcgatcgccgaccggctgtgggatctcgccggtcgacacgtgcggtag

DBGET integrated database retrieval system