KEGG   Halorubrum lacusprofundi: Hlac_1608Help
Entry
Hlac_1608         CDS       T00856                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hlac_1608
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hlac_1608
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hlac_1608
Enzymes [BR:hla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hlac_1608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1626960..1628207)
Genome map
AA seq 415 aa AA seqDB search
METTDAFTGLSCVGCGGTFDPETATHQCPDCGGILDPAYDLDRVDLSPEDLAERPFESMW
RYGELLPFAPEAAVSLGEGATPLVECPALADAMGVGRVLLKDEGANPTGTFKDRGQSLAM
TAARQHGAADIALNSAGNAGQAAAAYAARADLDAHVYLPSRAGFTQKAMTEVHGADLTVT
DPIDGNSQIGDAGRAYADAMDAHPDWYSAKTFVTPYRHEGKKTMALELLEQLDWEAPDGV
VYPTGGGVGLVGMHKAAHEVRELGWTDELVPMYAAQAAGCAPVVDAYEAGADRHEPVPDD
EVDTACNGIAIPDPGASPLILDAIRESEGGAVATTDREILDAAIEVARAEGLEVGATCAA
CVSGAFALAESGEFGPDDTVVLLNTGAGNKDVDALRAHLGEREVEAEATNDGGAP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgacagacgcgttcacagggctctcgtgtgtcggctgcggcgggacgttcgat
ccggagaccgcgacgcatcagtgtcccgactgcggcgggatcctcgacccggcgtacgac
ctcgatcgagtcgacctctcacccgaggacctcgcggaacgcccgttcgagtcgatgtgg
cggtacggggagctgctgccgttcgcgccggaggcggcggtgtcgctcggtgagggcgcg
acaccgctcgtcgagtgtccggcgctcgcggacgcgatgggtgtgggacgggtcctccta
aaagacgagggcgcgaacccgacgggaacgttcaaagaccgagggcagtcgctcgcgatg
acggccgcgcgccagcacggcgccgccgacatcgcgctgaacagcgccggcaacgcggga
caggcagcggccgcgtacgcggcccgtgcggatctggacgcgcacgtgtacctcccgtcg
cgggcggggttcacccaaaaggcgatgaccgaggtccacggcgccgatctcaccgtgacg
gatccgatcgacggcaactcgcagatcggcgacgccgggcgggcgtacgccgacgcgatg
gacgcacaccccgactggtactcggcaaagacgttcgtgacgccgtaccgccacgaggga
aagaagacgatggcgttagagctgctcgaacagctcgactgggaggcgcccgacggcgtc
gtctaccccaccggcgggggcgtcggcctcgtggggatgcacaaggccgcccacgaggtt
cgggagttgggatggaccgacgaactcgtcccgatgtacgccgcgcaggcggcgggctgt
gcacccgtcgtcgacgcatacgaggcgggagccgaccgccacgagccggttcccgacgac
gaggtcgacacggcctgcaacgggatcgcgatcccggacccgggagcgagcccgctcatc
ctcgacgcgatccgggagtctgagggtggcgcggtggcgacgaccgaccgcgagatcctc
gacgccgcgatcgaagtcgctcgggcggaggggctggaggtcggcgcgacctgcgcggcc
tgcgtctcgggggcgttcgcgctggcggagtcgggggagttcggtcccgacgacacggtc
gtcctcttgaacaccggcgcgggaaacaaagacgtcgacgcgcttcgggcgcacctcggc
gagcgggaggttgaggccgaggcgacgaacgacggcggcgctccgtga

DBGET integrated database retrieval system