KEGG   Halorubrum lacusprofundi: Hlac_1720Help
Entry
Hlac_1720         CDS       T00856                                 

Gene name
carB
Definition
carbamoyl phosphate synthase large subunit
Orthology
K01955  
carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
hla  Halorubrum lacusprofundi
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hla00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hla00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1735212..1738433
Genome map
AA seq 1073 aa AA seqDB search
MSEDRTILLIGSGPIQIGQAAEFDYSGAQACRALQEEGARVVLVNSNPATIMTDPETADR
VYIEPITPEAISEVIRIEEPDGVIAGLGGQTGLNVTAELAEEGILEEYDVEVMGTPLDTI
YATEDRDLFRQRMEGLGQPVPASTTISLDEGESVTDFDEEAFRGRVQAAVDEVGGLPVIA
RTTYTLGGSGSGVVDDFEELVERVRKGLRLSRNSEVLITESIAGWVELEYEVMRDADDSC
IIICNMENIDPMGIHTGESTVVTPSQVIPDDGHQEMRDAALEVIRDLGIQGGCNIQFAWH
DDGTPGGEYRVVEVNPRVSRSSALASKATGYPIARVTAKVALGKRLPEIDNEITGETTAA
FEPAIDYVVTKVPRWPIDKFDDVDFELGTAMKSTGEAMAIGRNFEESLLKSLRSSEYDPA
VDWPAIDDETLETEYLERPTPDRPYAIFEAFDRGYTVADVEDLTGIKPWYLERFKRVSDS
AQAAQNGEFAQAATAGHTNADIAALDGGVDVETVEEDVPGRTYKQVDTCAGEFAAETPYY
YSARQSEFNRGPLKGDAAAGELVVDKSVDSVVVVGGGPIRIGQGVEFDYCSVHAIQALRE
LGIEAHVVNNNPETVSTDYDTSDGLFFDPITAEEVADVVEATGADGVMVQFGGQTSVNIG
EPLEAELQRRGLDCEIMGTSVEAMDLAEDRDRFNVLMDEMGIAQPKGGTATSESEALELA
HDLGYPVLVRPSYVLGGRAMRVVEDDAELEEYIEEAVRVSPDKPILVDQFLDDAVELDVD
AVADGDDVLLGGVMEHVESAGVHSGDSACMIPPRSLGEETLARVREVTEDIARALDTVGL
LNVQLAVTGVGDDDAESEVYVLEANPRSSRTVPFVSKSTGVPIAKLAAKVMTDDLTLADL
DVDEQIPEHRSVKEVVLPFDRLPGSDPRLGPEMKSTGEVMGTARSFGKAYDKAQDSTNKP
IPESGTAVVDLSADEFPDPDTEAGESLVAGYAEHFELSEATDLIEAAKRGEIDLIVSRQR
ELLEVAVEEEITYFSTHASAKAALEAIDHKGDDLDVMAVSDRPKRVENWGAAE
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggaccggacgatactactcatcggcagcggaccgatccagatcggacaggcg
gccgagttcgactactccggggcacaggcgtgccgcgcccttcaggaggagggcgctcgc
gtcgtcctggtgaactcgaacccggcgacgatcatgaccgaccccgagaccgcagaccgg
gtgtacatcgagccgatcacgcccgaggcgatctcggaagtcatccggatcgaggagccc
gacggcgtcatcgccggactcggcggccagaccgggctcaacgtcaccgccgaactcgcg
gaggagggaattttggaggagtacgacgtcgaggtgatggggacgccgctcgacaccatc
tacgcgacggaggaccgcgacctgttccgccagcggatggagggtctgggccagccggtt
cccgcctcgacgaccatctcgctcgacgagggcgagtcggtcaccgacttcgacgaggag
gccttccgcgggcgcgtgcaggccgccgtcgacgaggtcggcgggctccccgttatcgcc
cggacgacgtacaccctcggcggctccggctccggcgtcgtcgacgacttcgaggaactg
gtcgaacgcgtccgcaaggggctccgcctctcgcggaacagcgaggtgctcatcaccgag
tccatcgctggctgggtcgaactggagtacgaagtgatgcgggacgccgacgactcctgt
atcatcatctgcaacatggagaacatcgacccgatggggatccacaccggggagtcgacg
gtcgtcaccccctcgcaggtgattcccgacgacgggcatcaggagatgcgcgacgccgcg
cttgaagtaattcgggatctgggcattcagggcgggtgtaacatccagttcgcgtggcac
gacgacgggacgccgggcggcgagtaccgcgtggtggaagtgaacccgcgcgtctcccgc
tcctccgcgctcgcgtcgaaggcgaccggctacccgatcgctcgcgtcaccgcgaaggtc
gcgctgggcaagcggctccccgagatcgacaacgagatcaccggcgagaccactgccgcc
ttcgagcccgccatcgactacgtagtgacgaaggtgccacgctggcccatcgacaagttc
gacgacgtggatttcgaactcggcaccgcgatgaagtccacgggcgaggcgatggcgatc
ggccggaacttcgaggagagcctgctgaagtcgctccgctcctccgagtacgaccccgcc
gtcgattggcccgcgatcgacgacgagacccttgagaccgagtacctcgaacgccccacg
ccggaccgcccgtacgcgatcttcgaggcgttcgaccgcggctacaccgtcgcggacgtc
gaggacctgaccgggatcaagccgtggtacctcgagcggttcaagcgcgtcagcgactcc
gcgcaggccgcgcagaacggcgagttcgcacaggcggccaccgcgggccacaccaacgcc
gacatcgcggccctcgacggcggcgtcgacgtcgagaccgtggaggaggacgttcccggc
cggacgtacaaacaggtcgacacctgtgccggcgagttcgccgccgagaccccgtactac
tactccgcccgtcagtccgagttcaaccggggaccgctgaagggcgacgccgcggccggc
gagctcgtcgtcgacaagagcgtcgacagcgtggtcgtcgtcggcggcgggccgatccgg
atcgggcagggcgtcgagttcgactactgctcggtccacgcgattcaggcgcttcgcgag
ctcggtatcgaggcgcacgtcgtcaacaacaaccccgagaccgtctcgaccgactacgac
acctccgacgggttgttcttcgacccgatcaccgccgaggaggtcgccgacgtggtcgag
gcgaccggcgccgacggcgtgatggttcagttcggcggacagacgtcggtcaacatcggc
gaaccgctcgaagcggaactccagcgccgcgggcttgactgcgagataatgggcacgagc
gtcgaggcgatggacttagcggaggaccgcgaccggttcaacgtcctgatggacgagatg
gggatcgcccagccgaagggcggcaccgcgacgagcgagagtgaggcgctcgaactcgct
cacgatctcgggtaccccgtcctcgtgcgcccctcctacgtgctgggcgggcgtgcgatg
cgggtcgtcgaggacgacgcggaactcgaagagtacatcgaggaggcggtccgggtctca
cccgacaagccgatcttagtcgaccagttcctcgacgacgcggtcgaactggacgtcgac
gccgtagcggacggggatgacgtgctgctcggcggcgtgatggagcacgtcgagagcgcg
ggcgtccactcgggcgactccgcctgtatgattccgccgcgctcgctgggcgaggagacg
ctggctcgggtccgcgaggtcaccgaggacatcgcccgcgcgctcgacaccgtcggcctg
ctcaacgtccagctcgcggtaacgggcgtcggcgacgacgacgccgaaagcgaggtgtac
gtgctggaggcgaacccgcgctcctcgcggacggtcccgttcgtctcgaagtcgacgggc
gtccccatcgcgaagctggctgcgaaggtgatgaccgacgacctgacgctcgccgacctc
gacgtcgacgagcagatccccgaacaccgcagcgtgaaggaggtcgtcctcccgttcgac
cgcctgccgggatcggacccgcggctcggcccggagatgaagtcgaccggcgaagtgatg
gggacggcccgctcgttcgggaaggcgtacgacaaggcgcaggactcgacgaacaagccg
atccccgagtccggtaccgccgtcgtcgacctctcggccgacgagttcccggacccggac
accgaggccggcgagtccctcgtcgcggggtacgccgagcacttcgagctgagcgaggcg
acggacctgatcgaggccgcgaagcgcggcgagatcgacctcatcgtctcccggcagcgc
gagctgctcgaagtggcggtcgaagaggagatcacctacttctcgacgcacgcctccgcg
aaggcggcgctcgaagctatcgaccacaagggcgacgacctcgacgtgatggccgtctcc
gaccggccgaagcgcgtcgagaactggggcgccgcagagtag

DBGET integrated database retrieval system